KEGG   Ailuropoda melanoleuca (giant panda): 100484040Help
Entry
100484040         CDS       T01329                                 

Definition
ribonuclease P protein subunit p20-like
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:aml03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:aml03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 136 aa AA seqDB search
MAENREPRGAVEGELDPVEXRPPHRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGSRGQN
SCSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAASTSTVELVDELEPETDTREPLTRI
RNNSAIHIRVFRVTPK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaaccgagagccccgcggggccgtcgagggtgagctggacccggtggagnnt
cgccccccccaccgcctgccccggaggcccaatgacatttatgtcaacatgaagactgac
tttaaggcccagctggcccgctgccaaaagcttctggacggagggtctcggggtcagaat
tcatgcagtgagatctacattcatggcctgggcctggccatcaaccgtgccatcaacatt
gccctacagcttcaggcgggcagcttcgggtccttgcaggtggctgccagtacctccacc
gtggagcttgtggatgaactggaaccagagactgatacacgcgagccactgacccgcatc
cgcaacaactcggccatccacatccgtgtcttcagggttacacccaagtaa

DBGET integrated database retrieval system