KEGG   Ailuropoda melanoleuca (giant panda): 100484040Help
Entry
100484040         CDS       T01329                                 

Definition
ribonuclease P protein subunit p20-like
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100484040
   03008 Ribosome biogenesis in eukaryotes
    100484040
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     100484040
Ribosome biogenesis [BR:aml03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     100484040
Transfer RNA biogenesis [BR:aml03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    100484040
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    100484040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 136 aa AA seqDB search
MAENREPRGAVEGELDPVEXRPPHRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGSRGQN
SCSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAASTSTVELVDELEPETDTREPLTRI
RNNSAIHIRVFRVTPK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaaccgagagccccgcggggccgtcgagggtgagctggacccggtggagnnt
cgccccccccaccgcctgccccggaggcccaatgacatttatgtcaacatgaagactgac
tttaaggcccagctggcccgctgccaaaagcttctggacggagggtctcggggtcagaat
tcatgcagtgagatctacattcatggcctgggcctggccatcaaccgtgccatcaacatt
gccctacagcttcaggcgggcagcttcgggtccttgcaggtggctgccagtacctccacc
gtggagcttgtggatgaactggaaccagagactgatacacgcgagccactgacccgcatc
cgcaacaactcggccatccacatccgtgtcttcagggttacacccaagtaa

DBGET integrated database retrieval system