KEGG   Ailuropoda melanoleuca (giant panda): 100484063Help
Entry
100484063         CDS       T01329                                 

Definition
calcium-activated potassium channel subunit beta-3-like
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Vascular smooth muscle contraction
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:aml04911]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:aml04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 281 aa AA seqDB search
MFPFLYELIEISSSSFPQRTAFSASGRNRNIDHSDGGVPDVRRKLPSSAGEDRAVLLGFA
MMGFSVLMFFLFGITVLRPFLLSTQREESNCTIIHTQIMDDWMDCAFTCGVDCRGQGKYP
CLQVFVKLTHSGQKALLHYNEEAVQINSKCFYTPKCHRDRNDLLNSALDIKEFFDHKNGT
PFSCFYSPDSRSEDVILIKKYDYMVLFHCLFWPTLTLLGGALIVGMVRLTQYLSLLCEQY
STARRDEAGGKVPSAEQHRFKLWSVGRSQERSREILRWWPD
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgttcccttttctctatgagcttattgaaatatcttcttcctccttcccccaaaggaca
gccttttctgcctcagggaggaatagaaatatagaccacagtgatggtggcgtcccagac
gtgcgcaggaagctaccgtccagtgctggagaggaccgagccgtgctgctagggtttgca
atgatgggcttctcagtcctcatgttcttcttgtttggaataaccgtcctcaggcctttc
ttgctcagcactcagagagaagaatcaaactgcactatcatccacactcagatcatggat
gactggatggactgtgctttcacctgcggtgtggactgccgaggccagggcaagtaccca
tgtcttcaggtgtttgtgaagctcacccattcaggtcagaaagctctcctgcattataat
gaagaggctgtccagataaattccaagtgcttttacacgcctaagtgccaccgagacagg
aatgatttgctcaacagtgctctggacataaaggaattttttgatcacaaaaatgggacc
cccttttcatgcttctacagtccagacagccggtctgaagatgtcattctcataaaaaag
tacgactacatggttctcttccactgcttgttctggccgacgctgaccctgctagggggt
gccctgattgtgggcatggtgagattgacacagtacctgtccctgctgtgcgagcaatac
agcaccgcgcgcagagatgaggcaggcggcaaagtaccttctgcggaacagcatcgattc
aaactgtggagtgtggggaggagccaagaaaggagcagagaaatcttacgatggtggcca
gattag

DBGET integrated database retrieval system