KEGG   Ailuropoda melanoleuca (giant panda): 100484183Help
Entry
100484183         CDS       T01329                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 3-like
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100484183
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100484183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 723 aa AA seqDB search
MRVWDNESPSPPGGAPVRHFENGCFSPRGSVGLVFQEEETNSTNIPKKKNRKSLPGGLVQ
PKEGWEFDRPNWKILGKQGSPGLSFLVASGERRRADLQCLDEIPSGTAAPGQPPQRKRIL
PSEPSNRRPSPLGSRASPRPARGPGRKDAEPPGAGLPPQQRRLGDGVYDTFMMIDETKCP
PCSNVLCNPSEPPLPRRLNITAEQLPRDHTQRFLNGGEVKVEQLFQEFGNRRSDTLQSDG
INDSEKCSPPDSQGKSSDSLNAVKPSSSAKASKVVPLTPEQALKQYKHHLTAYEKLEIIN
YPEIYFVGPNAKKRHGVIGGPNNSGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVA
RVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHV
CMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLK
HHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLT
GQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGLPRYCSVTTQADGRVVL
VGGRSRRGKKRGPPGSKDWVTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISK
CVPRPLTIEKVSGKRVVNPTNAFQGLGSKLPPVVGIANKLKANLMSETNGGIPLCSVLPK
LIS
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtttgggacaatgagtccccatccccaccaggtggcgcccctgttcggcatttt
gagaacggttgtttctcgcctcgagggtctgtcggcctcgtgttccaagaggaagaaaca
aactccacaaatattcccaagaaaaaaaacaggaagagccttccagggggcctggtgcag
ccaaaggaaggctgggaatttgaccgccccaactggaagatcctggggaagcagggctcc
cctggcctcagtttcctcgtagcgagtggagagcgaaggcgcgcggatctgcagtgtctg
gacgagattccctcgggaaccgcggccccggggcagccgccccagcgcaagcggatcttg
ccctccgaaccctccaaccgccgcccctcccccctggggtcccgagctagcccgaggccg
gcgcgcgggcccgggcggaaggatgcggagccgcctggagccggactcccgccccagcag
cggagattgggggatggtgtctatgataccttcatgatgatagatgaaaccaaatgtcca
ccctgttcaaatgtactctgcaatccttctgaaccgcctctaccccgaagactaaatatc
actgctgagcagttaccaagagatcacactcagcgctttctgaatggaggtgaggtgaaa
gtagaacagctgtttcaagaatttggcaacagaagatctgatactcttcagtcagatggc
atcaacgactctgaaaaatgctctcctcccgactctcagggtaaaagttcagatagcttg
aatgcggtgaaacccagcagttcagccaaagcttccaaagtggtgccactgactccagag
caagcactgaagcaatacaaacaccacctcactgcttacgagaagctggaaatcatcaat
tacccagaaatttactttgtgggcccaaatgccaaaaaaagacacggagtgatcggtggt
cccaataacagcgggtatgatgatgcagatggggcctatattcatgtgcctcgtgaccat
ctggcttatcgatatgaggtgctgaaaattattggcaagggaagttttgggcaagtagcc
cgggtctacgatcataaacttcgacagtatgtggccctaaagatggtacgcaatgaaaag
cgcttccatcgtcaagcagctgaggagatccggattttggagcatcttaaaaagcaggac
aagacgggtagcatgaatgtcatccacatgctggaaagtttcacattccggaatcatgtt
tgcatggccttcgaattgctgagcatagacctttatgagctaattaaaaaaaacaagttt
cagggttttagcgtccagttagttcgcaagtttgctcaatccatcttgcaatccttggat
gctctccacaaaaataagatcattcactgtgacctgaagccagaaaacattctcctgaaa
caccatgggcgcagtgcgaccaaggtcattgactttgggtccagctgtttcgaataccag
aagctttacacatatatccagtctcggttctacagagctccagagatcatcttagggagc
cgctacagcacgcctatagacatatggagttttggctgcatccttgcagaacttttaaca
ggacagcctctcttcccgggagaggatgaaggagaccagttggcctgtatgatggagctg
ctaggaatgccaccaccaaaacttctggagcaatccaaacgtgccaagtacttcattaac
tccaagggcctacctcgctactgttctgtgactactcaggcagacgggagggttgtactt
gtggggggtcgctcacgtaggggtaaaaagcggggtcccccaggcagcaaagactgggtg
acagcactgaagggatgtgatgactacttgtttatagagtttttgaaaaggtgtcttcac
tgggacccctctgcccgtttgaccccagctcaagcactgagacatccatggattagtaag
tgtgtgcccagacctctcaccattgaaaaggtgtcaggaaaacgggtggtaaatcccaca
aacgctttccagggactgggttccaagctgcctccagttgtcggaatagccaataagctt
aaagctaacttaatgtcagaaaccaatggtggtatacctctgtgcagtgtactgccaaag
ctcattagctaa

DBGET integrated database retrieval system