KEGG   Ailuropoda melanoleuca (giant panda): 100484294Help
Entry
100484294         CDS       T01329                                 

Gene name
UGP2
Definition
(RefSeq) UDP-glucose pyrophosphorylase 2
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00040  Pentose and glucuronate interconversions
aml00052  Galactose metabolism
aml00500  Starch and sucrose metabolism
aml00520  Amino sugar and nucleotide sugar metabolism
aml01100  Metabolic pathways
Module
aml_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
aml_M00361  Nucleotide sugar biosynthesis, eukaryotes
aml_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100484294 (UGP2)
   00052 Galactose metabolism
    100484294 (UGP2)
   00500 Starch and sucrose metabolism
    100484294 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    100484294 (UGP2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100484294 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 100484294
NCBI-ProteinID: XP_002926318
Ensembl: ENSAMEG00000001229
Position
Un
AA seq 508 aa AA seqDB search
MSRYVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTAPSHEFEHTKKDLDGFRK
LFHRFLQEKGPSVDWGKIQRPPEDLIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNH
CRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTLI
GEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKPCEFVMEVTNKTRADVKGGTLTQYEG
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNPKTLD
GGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagatatgtacaagatcttagcaaagccatgtctcaagatggcgcgtctcagttt
caagaagtcattcgacaagaactagaattatctgtgaagaaggaactagaaaaaatactt
accacagcaccatcacatgagtttgagcacactaaaaaagaccttgatggatttcggaag
ctatttcatagatttctgcaagaaaaggggccttctgtagattggggaaaaatccagaga
cctccagaagatttgattcaaccctatgaaaagataaaggccagaggcttacctgataat
atatcttctgtgctgaacaagctggtggtggtgaaactcaatggaggtttgggaaccagc
atgggctgcaaaggcccaaaaagtctgatcggtgtgaggaatgagaatacctttttggat
ctgaccgttcagcaaattgaacatttgaacaaaacctacaatacagatgttcctcttgtt
ctaatgaactcttttaacacggatgaagatacaaaaaaaatactacagaagtacaatcac
tgtcgtgtgaaaatctacacttttaatcaaagcaggtacccgaggattaataaagaatct
ttactgcctgtagcaaaggacgtctcatactcaggggaaaatacagaagcttggtaccct
ccaggtcatggtgatatttacgccagtttctacaactctggtttgctcgacacccttata
ggagaaggcaaagagtatatttttgtgtctaacatagataatctgggtgctaccgtggat
ctttatattcttaatcatctaatgaacccacccaatggaaaaccctgtgaatttgtcatg
gaagtcacaaataaaacacgtgcagatgtaaagggtgggacacttacccagtatgaaggc
aaattgagacttgtggaaatcgctcaagtgccaaaagcacatgttgatgagttcaagtct
gtatcaaaattcaaaatatttaacacaaacaacctatggatctctcttgcagcagttaaa
agactgcaggagcaaaatgctattgatatggagatcattgtgaatccaaagactttggat
ggaggcctgaatgtcattcagttagaaactgcagtaggggctgccattaaaagttttgag
aattctctaggtattaatgttcctaggagccgctttctacctgtcaaaaccacatcagat
ctcttgctggtgatgtcaaacctttatagccttaatgcaggatctttgacaatgagcgaa
aagcgggaatttcctacagtacccttggttaaattaggcagttcttttacaaaggttcag
gattatctaaggagatttgaaagtataccagatatgcttgaattggatcacctcacagtt
tcaggagatgtgacatttggcaagaatgtttcactaaagggaacagttatcatcattgca
aatcacggtgaccgaatcgacatcccacctggagcagtattagagaacaagattgtatca
gggaaccttcgtatcttggaccactga

DBGET integrated database retrieval system