KEGG   Ailuropoda melanoleuca (giant panda): 100484294Help
Entry
100484294         CDS       T01329                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase-like
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100484294
   00052 Galactose metabolism
    100484294
   00500 Starch and sucrose metabolism
    100484294
   00520 Amino sugar and nucleotide sugar metabolism
    100484294
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100484294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 508 aa AA seqDB search
MSRYVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTAPSHEFEHTKKDLDGFRK
LFHRFLQEKGPSVDWGKIQRPPEDLIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNH
CRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTLI
GEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKPCEFVMEVTNKTRADVKGGTLTQYEG
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNPKTLD
GGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagatatgtacaagatcttagcaaagccatgtctcaagatggcgcgtctcagttt
caagaagtcattcgacaagaactagaattatctgtgaagaaggaactagaaaaaatactt
accacagcaccatcacatgagtttgagcacactaaaaaagaccttgatggatttcggaag
ctatttcatagatttctgcaagaaaaggggccttctgtagattggggaaaaatccagaga
cctccagaagatttgattcaaccctatgaaaagataaaggccagaggcttacctgataat
atatcttctgtgctgaacaagctggtggtggtgaaactcaatggaggtttgggaaccagc
atgggctgcaaaggcccaaaaagtctgatcggtgtgaggaatgagaatacctttttggat
ctgaccgttcagcaaattgaacatttgaacaaaacctacaatacagatgttcctcttgtt
ctaatgaactcttttaacacggatgaagatacaaaaaaaatactacagaagtacaatcac
tgtcgtgtgaaaatctacacttttaatcaaagcaggtacccgaggattaataaagaatct
ttactgcctgtagcaaaggacgtctcatactcaggggaaaatacagaagcttggtaccct
ccaggtcatggtgatatttacgccagtttctacaactctggtttgctcgacacccttata
ggagaaggcaaagagtatatttttgtgtctaacatagataatctgggtgctaccgtggat
ctttatattcttaatcatctaatgaacccacccaatggaaaaccctgtgaatttgtcatg
gaagtcacaaataaaacacgtgcagatgtaaagggtgggacacttacccagtatgaaggc
aaattgagacttgtggaaatcgctcaagtgccaaaagcacatgttgatgagttcaagtct
gtatcaaaattcaaaatatttaacacaaacaacctatggatctctcttgcagcagttaaa
agactgcaggagcaaaatgctattgatatggagatcattgtgaatccaaagactttggat
ggaggcctgaatgtcattcagttagaaactgcagtaggggctgccattaaaagttttgag
aattctctaggtattaatgttcctaggagccgctttctacctgtcaaaaccacatcagat
ctcttgctggtgatgtcaaacctttatagccttaatgcaggatctttgacaatgagcgaa
aagcgggaatttcctacagtacccttggttaaattaggcagttcttttacaaaggttcag
gattatctaaggagatttgaaagtataccagatatgcttgaattggatcacctcacagtt
tcaggagatgtgacatttggcaagaatgtttcactaaagggaacagttatcatcattgca
aatcacggtgaccgaatcgacatcccacctggagcagtattagagaacaagattgtatca
gggaaccttcgtatcttggaccactga

DBGET integrated database retrieval system