KEGG   Ailuropoda melanoleuca (giant panda): 100484452Help
Entry
100484452         CDS       T01329                                 

Definition
AP-1 complex subunit beta-1-like
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100484452
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100484452
  Nervous system
   04721 Synaptic vesicle cycle
    100484452
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100484452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 952 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVWKTAAAFCVAEFHDISAQMAEDQGFLDSLRDLIADSNPMVVAN
AVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQS
ICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQ
YVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELK
EYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFR
KYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQ
VQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKE
VVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGS
TDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGG
LDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPG
GYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVI
PSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVL
FVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQD
MLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtacttcacaaccaataaaaaaggagaaatctttgaattaaaggct
gaactcaacaacgaaaagaaagaaaagaggaaggaggctgtgaagaaagtgattgctgcc
atgactgtggggaaggacgttagttctctctttccagatgtagtgaactgtatgcaaacc
gacaacttagaattaaagaagcttgtttatctctatttgatgaactacgccaagagtcag
ccagacatggccatcatggctgtcaacagctttgtgaaggactgtgaagatcccaatcct
ctgattcgagccttggcagtcaggaccatggggtgcatccgggtggacaagattacagaa
tatctctgtgagcctctccgcaagtgcttgaaggatgaagatccctatgtttggaaaaca
gcagcagcattttgtgtggcagaattccatgacatcagtgcccaaatggcagaagatcag
ggatttctggattctctgcgggatctcatagcagattcaaatccaatggtggtggctaat
gctgtagcagcattatctgaaatcagtgaatctcacccaaacagcaacctactcgatctg
aacccacagaacattaacaagctgctgacagccctgaatgagtgcactgaatggggccag
attttcatcttggactgcctgtctaattacaaccctaaagatgaccgggaggctcagagc
atctgtgagcgtgtaactccccggctatctcatgccaactcagcagtggtgctttcagcg
gttaaagtcctaatgaagtttctagagttgttacccaaggactctgactactacaatatg
ctgctgaagaagttggcccctccgcttgtcactttgctgtctggggagccagaggtgcag
tacgtcgccctgaggaatatcaatctaattgtccagaaaaggcctgaaatcttgaagcag
gaaatcaaagtcttctttgtgaagtacaatgatcccatctatgttaaactagagaaattg
gacatcatgattcgtttagcatcccaagccaacattgctcaggttctggcggaattaaag
gaatacgccacagaggtggatgtggactttgttcgcaaggctgtgagggccattggacgg
tgtgccatcaaagtggagcaatctgcagagcgctgtgtgagcacattgcttgatctcatc
cagaccaaagtaaattatgtggtccaagaggcaattgttgtcatcagggacatctttcgc
aagtaccccaacaagtatgaaagtatcattgccactctgtgtgagaacttagactctctg
gatgaaccggatgctcgagcagctatgatttggattgtgggagaatatgctgagagaatt
gacaatgcagatgagttattagagagcttcctggagggttttcatgatgaaagcacccag
gtgcagctcactctgcttactgccatcgtgaagctgtttctcaagaaaccatcagaaaca
caggagctggtacagcaagtcttgagtttggcaacacaggattctgataatcctgacctt
cgagaccggggctatatttattggcgccttctctcaacggaccctgtcacagccaaagaa
gtagtcttgtctgagaagccactgatctccgaggagacagatcttattgagccaactctg
ctggatgagctcatctgccacattggatctttggcttcagtgtaccataagcctcccaat
gcttttgtggaaggaagtcatggaatccatcgcaaacacttgccaatacatcatgggagc
actgatgcaggtgacagccctgttggcaccaccactgccacaaacctggaacagcctcag
gttatcccctctcaaggggaccttctaggagaccttttaaaccttgaccttggtccccca
gtcaatgtgccacaggtgtcctccatgcagatgggagcagtggatctcttgggaggagga
ctagatagtctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtggga
caatccttcatcccctcatcagtgcctgcaacctttgctccttcacctactcctgctgtg
gtcagcagtggtctgaatgacctgtttgaactctccacgggaataggcatggcacctggt
ggatatgtggctcctaaggctgtctggttgcctgcagtaaaagctaaaggcttggagatt
tccggaacttttactcaccgccaagggcacatctatatggaaatgaacttcaccaacaaa
gctctgcagcacatgacagactttgcaatccagtttaacaagaatagctttggtgtcatc
cccagcactcctctggccatccatacaccactgatgccaaaccagagcattgatgtctcg
ctgcctctcaacaccttgggcccagtcatgaagatggagcctctgaataacctgcaggtg
gctgtgaaaaacaatattgatgtcttttacttcagctgcctcatcccactcaatgtgctt
tttgtagaagatggcaaaatggagcgccaggtcttccttgccacgtggaaggatattccc
aatgaaaatgaacttcagtttcagattaaggaatgtcatttaaatgctgacactgtttcc
agcaaattgcaaaacaacaatgtttatacgattgccaagaggaatgtggaggggcaggac
atgctgtaccagtccctgaagctcactaatggtatttggattttggctgagctacgtatc
cagccaggaaacccaaattatacgctgtcgctgaagtgtagagctcccgaagtctctcag
tacatctatcaggtctacgacagcattttgaaaaactaa

DBGET integrated database retrieval system