KEGG   Ailuropoda melanoleuca (giant panda): 100484452Help
Entry
100484452         CDS       T01329                                 

Gene name
AP2B1
Definition
(RefSeq) adaptor-related protein complex 2, beta 1 subunit
  KO
K11825  
AP-2 complex subunit beta-1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100484452 (AP2B1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100484452 (AP2B1)
  Nervous system
   04721 Synaptic vesicle cycle
    100484452 (AP2B1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100484452 (AP2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 952 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVWKTAAAFCVAEFHDISAQMAEDQGFLDSLRDLIADSNPMVVAN
AVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQS
ICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQ
YVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELK
EYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFR
KYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQ
VQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKE
VVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGS
TDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGG
LDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPG
GYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVI
PSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVL
FVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQD
MLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtacttcacaaccaataaaaaaggagaaatctttgaattaaaggct
gaactcaacaacgaaaagaaagaaaagaggaaggaggctgtgaagaaagtgattgctgcc
atgactgtggggaaggacgttagttctctctttccagatgtagtgaactgtatgcaaacc
gacaacttagaattaaagaagcttgtttatctctatttgatgaactacgccaagagtcag
ccagacatggccatcatggctgtcaacagctttgtgaaggactgtgaagatcccaatcct
ctgattcgagccttggcagtcaggaccatggggtgcatccgggtggacaagattacagaa
tatctctgtgagcctctccgcaagtgcttgaaggatgaagatccctatgtttggaaaaca
gcagcagcattttgtgtggcagaattccatgacatcagtgcccaaatggcagaagatcag
ggatttctggattctctgcgggatctcatagcagattcaaatccaatggtggtggctaat
gctgtagcagcattatctgaaatcagtgaatctcacccaaacagcaacctactcgatctg
aacccacagaacattaacaagctgctgacagccctgaatgagtgcactgaatggggccag
attttcatcttggactgcctgtctaattacaaccctaaagatgaccgggaggctcagagc
atctgtgagcgtgtaactccccggctatctcatgccaactcagcagtggtgctttcagcg
gttaaagtcctaatgaagtttctagagttgttacccaaggactctgactactacaatatg
ctgctgaagaagttggcccctccgcttgtcactttgctgtctggggagccagaggtgcag
tacgtcgccctgaggaatatcaatctaattgtccagaaaaggcctgaaatcttgaagcag
gaaatcaaagtcttctttgtgaagtacaatgatcccatctatgttaaactagagaaattg
gacatcatgattcgtttagcatcccaagccaacattgctcaggttctggcggaattaaag
gaatacgccacagaggtggatgtggactttgttcgcaaggctgtgagggccattggacgg
tgtgccatcaaagtggagcaatctgcagagcgctgtgtgagcacattgcttgatctcatc
cagaccaaagtaaattatgtggtccaagaggcaattgttgtcatcagggacatctttcgc
aagtaccccaacaagtatgaaagtatcattgccactctgtgtgagaacttagactctctg
gatgaaccggatgctcgagcagctatgatttggattgtgggagaatatgctgagagaatt
gacaatgcagatgagttattagagagcttcctggagggttttcatgatgaaagcacccag
gtgcagctcactctgcttactgccatcgtgaagctgtttctcaagaaaccatcagaaaca
caggagctggtacagcaagtcttgagtttggcaacacaggattctgataatcctgacctt
cgagaccggggctatatttattggcgccttctctcaacggaccctgtcacagccaaagaa
gtagtcttgtctgagaagccactgatctccgaggagacagatcttattgagccaactctg
ctggatgagctcatctgccacattggatctttggcttcagtgtaccataagcctcccaat
gcttttgtggaaggaagtcatggaatccatcgcaaacacttgccaatacatcatgggagc
actgatgcaggtgacagccctgttggcaccaccactgccacaaacctggaacagcctcag
gttatcccctctcaaggggaccttctaggagaccttttaaaccttgaccttggtccccca
gtcaatgtgccacaggtgtcctccatgcagatgggagcagtggatctcttgggaggagga
ctagatagtctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtggga
caatccttcatcccctcatcagtgcctgcaacctttgctccttcacctactcctgctgtg
gtcagcagtggtctgaatgacctgtttgaactctccacgggaataggcatggcacctggt
ggatatgtggctcctaaggctgtctggttgcctgcagtaaaagctaaaggcttggagatt
tccggaacttttactcaccgccaagggcacatctatatggaaatgaacttcaccaacaaa
gctctgcagcacatgacagactttgcaatccagtttaacaagaatagctttggtgtcatc
cccagcactcctctggccatccatacaccactgatgccaaaccagagcattgatgtctcg
ctgcctctcaacaccttgggcccagtcatgaagatggagcctctgaataacctgcaggtg
gctgtgaaaaacaatattgatgtcttttacttcagctgcctcatcccactcaatgtgctt
tttgtagaagatggcaaaatggagcgccaggtcttccttgccacgtggaaggatattccc
aatgaaaatgaacttcagtttcagattaaggaatgtcatttaaatgctgacactgtttcc
agcaaattgcaaaacaacaatgtttatacgattgccaagaggaatgtggaggggcaggac
atgctgtaccagtccctgaagctcactaatggtatttggattttggctgagctacgtatc
cagccaggaaacccaaattatacgctgtcgctgaagtgtagagctcccgaagtctctcag
tacatctatcaggtctacgacagcattttgaaaaactaa

DBGET integrated database retrieval system