KEGG   Ailuropoda melanoleuca (giant panda): 100484456Help
Entry
100484456         CDS       T01329                                 

Definition
neuroendocrine convertase 2-like
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     100484456
Peptidases [BR:aml01002]
 Serine Peptidases
  Family S8: subtilisin family
   100484456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 599 aa AA seqDB search
VGIALLGLTEDIQLADNENKLPFTEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMAL
QQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGK
GVTIGIMDDGIDYLHPDLASNYNAEASYDFSGNDPYPYPRYTDDWFNSHGTRCAGEVSAA
ANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVD
GPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGR
TALYDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALE
ANLGLTWRDMQHLTVLTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDW
KTVPERFHCVGGSVQDPEKIPSTGKLVLSLTTDACEGKENFVRYLEHVQAVITVNATRRG
DLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSTA
QKGVLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILHKN
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gttggaattgctctgctgggactgactgaagatattcagttggctgacaatgagaacaag
cttcccttcactgaaggcctgtaccacttctatcacaatggccttgcaaaggccaagaga
agacgcagcctacatcacaaacagcagctggagagagaccccagggtaaagatggccttg
cagcaagaaggatttgacagaaagaagcgggggtatagagacatcaacgagattgatatc
aacatgaatgatcctctttttacaaagcagtggtatctgatcaataccggacaagctgat
ggcactcctggccttgatttgaacgtggcagaagcctgggagctgggatacacaggaaaa
ggtgttaccatcggaattatggatgatgggattgactatctgcacccggacctggcctcg
aactacaacgccgaggcgagctatgacttcagcggcaacgacccctatccttaccctcga
tacacagacgactggttcaacagccacgggacgcgatgtgcaggcgaggtttctgccgca
gccaacaacaatatctgtggggttggagtggcctacaactccaaggtcgcaggtatccgg
atgctggaccagccgttcatgacggacatcatcgaggcctcttccatcagccacatgcct
cagctgatcgacatctacagcgccagctggggcccgacagacaacgggaagacggtggac
gggccccgtgagctcacgcttcaggccatggccgacggcgtcaacaagggccgaggaggc
aaaggcagcatctacgtgtgggcctccggggacggtggcagctacgacgactgcaactgt
gacggctacgcctccagcatgtggaccatctccatcaactcggccatcaacgacggcagg
accgccctgtacgacgagagctgctcctccaccttggcctccaccttcagcaatggcagg
aagaggaaccccgaggccggcgtggcaaccacagatttgtacggcaactgcaccctgagg
cattctgggacatccgcagctgcgcccgaggcggctggagtgttcgcgctggctttggag
gctaacctgggtctgacctggagagacatgcagcatttgactgtgctcacctccaaacgg
aatcagcttcacgacgaggtccatcaatggcggaggaatggggttggcctggagtttaat
cacctctttggctacggggtccttgatgcgggcgccatggtgaaaatggcgaaagactgg
aaaaccgtgcctgagagattccactgtgtgggaggctccgtgcaggaccctgagaaaata
ccatccactggcaagcttgtgctgagcctcaccaccgatgcgtgtgaggggaaagaaaat
ttcgtccgttaccttgagcacgtccaagctgtcatcacagtcaatgccaccaggagagga
gacctgaacatcaacatgacttccccgatgggcaccaagtccatcttgctgagccggcgt
ccaagggatgacgactccaaggtgggctttgacaagtggcctttcatgaccacccacact
tggggggaagacgcccgaggaacctggaccctggagctggggttcgtcgggagcacagcc
cagaagggggtgctgaaggagtggacactgatgctgcatggcacgcagagcgcgccttac
atcgaccaggttgtgagggattaccagtccaagctggccatgtccaagaaggaggagctg
gaggaggagctggacgaagctgtggagagaagcctgaagagcatcctgcacaagaactag

DBGET integrated database retrieval system