KEGG   Ailuropoda melanoleuca (giant panda): 100484510Help
Entry
100484510         CDS       T01329                                 

Gene name
ASPDH
Definition
(RefSeq) aspartate dehydrogenase domain containing
  KO
K06989  aspartate dehydrogenase [EC:1.4.1.21]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00760  Nicotinate and nicotinamide metabolism
aml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100484510 (ASPDH)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.21  aspartate dehydrogenase
     100484510 (ASPDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF108 NAD_binding_3 F420_oxidored Shikimate_DH NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 100484510
NCBI-ProteinID: XP_011221467
Ensembl: ENSAMEG00000012955
Position
Un
AA seq 284 aa AA seqDB search
MALDRVPRRVGVVGYGRLGQSLVSHLLTQGPELGLELVFVWNRDPGRMAGSVPSSLQLQN
LAALGERHPDLVVEVAHPKIIQESGAQILRYASLLVGSPSALADQATEQQLLEASHRWNH
TVFVARGALWGTEDITRLDAAGGLQSLRVTMATHPDGFRLEGPLAAMPSTGRRTVLYEGP
VRGLCCFAPRNSNTMAAAALAAPSLGFDRVVGVLVADLSLTDMHVVDVELNGPLGPTGRR
FAVHTHRENPAEPGAVTGSATVTTFWRSLLGCCQLPSRPGIHLC
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgacagggtcccaaggagggtaggggtggtgggctacggccgccttggacag
tcccttgtttctcacctgctgactcagggaccagaactgggcctagaacttgtttttgtc
tggaatcgtgacccagggcgaatggcagggagtgtgccctcttccctgcaactccagaac
ctcgctgctcttggggagaggcaccctgaccttgtggtggaagtggcccatcctaaaata
atccaggaatctggggcacagatcctgcgctatgccagtctcctggtggggtccccctca
gccctggctgaccaggccacagagcagcagctcctggaggcctcgcaccgctggaaccac
actgtgtttgtggcccggggggccctgtggggcactgaggacatcaccagattggatgca
gctgggggcctccagagtcttcgcgtcaccatggccacgcacccagatggcttccggctc
gagggaccactggctgcgatgcccagcactgggcgtcgcactgtgctctatgaaggccct
gtgcgcgggctctgctgctttgccccccgaaactccaacaccatggcagctgccgcactg
gccgcccccagcctggggtttgatcgcgtggttggggtgcttgtggctgatctcagcctc
acagacatgcacgtggtggacgtggagctgaatggacccctgggccccacaggacgaagg
tttgctgtgcacacgcacagagagaatcctgccgagccaggcgctgtcacgggctctgcc
actgttaccaccttctggcgcagcctcctggggtgctgccagctcccctccaggccgggg
atccatctctgctga

DBGET integrated database retrieval system