KEGG   Ailuropoda melanoleuca (giant panda): 100484510Help
Entry
100484510         CDS       T01329                                 

Gene name
ASPDH
Definition
(RefSeq) aspartate dehydrogenase domain containing
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100484510 (ASPDH)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C86
   100484510 (ASPDH)
Ubiquitin system [BR:aml04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    100484510 (ASPDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 284 aa AA seqDB search
MALDRVPRRVGVVGYGRLGQSLVSHLLTQGPELGLELVFVWNRDPGRMAGSVPSSLQLQN
LAALGERHPDLVVEVAHPKIIQESGAQILRYASLLVGSPSALADQATEQQLLEASHRWNH
TVFVARGALWGTEDITRLDAAGGLQSLRVTMATHPDGFRLEGPLAAMPSTGRRTVLYEGP
VRGLCCFAPRNSNTMAAAALAAPSLGFDRVVGVLVADLSLTDMHVVDVELNGPLGPTGRR
FAVHTHRENPAEPGAVTGSATVTTFWRSLLGCCQLPSRPGIHLC
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgacagggtcccaaggagggtaggggtggtgggctacggccgccttggacag
tcccttgtttctcacctgctgactcagggaccagaactgggcctagaacttgtttttgtc
tggaatcgtgacccagggcgaatggcagggagtgtgccctcttccctgcaactccagaac
ctcgctgctcttggggagaggcaccctgaccttgtggtggaagtggcccatcctaaaata
atccaggaatctggggcacagatcctgcgctatgccagtctcctggtggggtccccctca
gccctggctgaccaggccacagagcagcagctcctggaggcctcgcaccgctggaaccac
actgtgtttgtggcccggggggccctgtggggcactgaggacatcaccagattggatgca
gctgggggcctccagagtcttcgcgtcaccatggccacgcacccagatggcttccggctc
gagggaccactggctgcgatgcccagcactgggcgtcgcactgtgctctatgaaggccct
gtgcgcgggctctgctgctttgccccccgaaactccaacaccatggcagctgccgcactg
gccgcccccagcctggggtttgatcgcgtggttggggtgcttgtggctgatctcagcctc
acagacatgcacgtggtggacgtggagctgaatggacccctgggccccacaggacgaagg
tttgctgtgcacacgcacagagagaatcctgccgagccaggcgctgtcacgggctctgcc
actgttaccaccttctggcgcagcctcctggggtgctgccagctcccctccaggccgggg
atccatctctgctga

DBGET integrated database retrieval system