KEGG   Ailuropoda melanoleuca (giant panda): 100484553Help
Entry
100484553         CDS       T01329                                 

Definition
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2-like
Orthology
K04537  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100484553
   04151 PI3K-Akt signaling pathway
    100484553
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    100484553
  Nervous system
   04724 Glutamatergic synapse
    100484553
   04727 GABAergic synapse
    100484553
   04725 Cholinergic synapse
    100484553
   04728 Dopaminergic synapse
    100484553
   04726 Serotonergic synapse
    100484553
   04723 Retrograde endocannabinoid signaling
    100484553
  Environmental adaptation
   04713 Circadian entrainment
    100484553
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100484553
  Substance dependence
   05032 Morphine addiction
    100484553
   05034 Alcoholism
    100484553
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100484553
GTP-binding proteins [BR:aml04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100484553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAGGPGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggctgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggattcaacactgacccagatcacagctgggctggacccagtg
gggagaatccagatgaggacacggaggaccctccgtgggcacctggcaaaaatctatgcc
atgcactgggggacagactcaaggctgctggtcagtgcctcccaggatgggaagctcatc
atttgggacagctataccaccaacaaggtccatgccatccctctgcgctcctcctgggtc
atgacctgtgcctatgcgccctcagggaactttgtggcctgtggagggctggacaacatc
tgctccatctacagcctcaagacccgcgagggcaatgtccgggtcagccgggaattgcct
ggccacaccgggtacctgtcgtgctgccgcttcctggatgacaaccaaatcatcaccagc
tccggggacaccacctgtgccctgtgggacattgagacaggccagcagacagtgggtttt
gctgggcacagtggagatgtgatgtccctgtcactggcccccgatggccgcacctttgtg
tctggtgcctgtgacgcctccatcaagctgtgggacgtgcgggattctatgtgccgacag
accttcatcggccacgagtcagacatcaatgccgtggcgttcttccccaacggctacgcc
ttcaccactggctccgatgatgccacgtgccgcctcttcgacctgcgggctgaccaggag
ctgctcatgtactcccacgacaacatcatctgcggcatcacctctgttgccttctcccgc
agcggccggctgctgctcgccggctacgacgacttcaactgcaacatctgggacgccatg
aagggcgaccgtgcaggtgtcctcgccggccacgacaaccgtgtgagctgcctcggggtc
accgatgatggcatggctgggggcccaggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system