KEGG   Ailuropoda melanoleuca (giant panda): 100484553Help
Entry
100484553         CDS       T01329                                 

Definition
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2-like
Orthology
K04537  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:aml04014]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:aml04151]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:aml04062]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:aml04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:aml04727]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:aml04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:aml04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:aml04726]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:aml04723]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:aml04713]
Human Diseases; Substance dependence; Morphine addiction [PATH:aml05032]
Human Diseases; Substance dependence; Alcoholism [PATH:aml05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAGGPGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggctgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggattcaacactgacccagatcacagctgggctggacccagtg
gggagaatccagatgaggacacggaggaccctccgtgggcacctggcaaaaatctatgcc
atgcactgggggacagactcaaggctgctggtcagtgcctcccaggatgggaagctcatc
atttgggacagctataccaccaacaaggtccatgccatccctctgcgctcctcctgggtc
atgacctgtgcctatgcgccctcagggaactttgtggcctgtggagggctggacaacatc
tgctccatctacagcctcaagacccgcgagggcaatgtccgggtcagccgggaattgcct
ggccacaccgggtacctgtcgtgctgccgcttcctggatgacaaccaaatcatcaccagc
tccggggacaccacctgtgccctgtgggacattgagacaggccagcagacagtgggtttt
gctgggcacagtggagatgtgatgtccctgtcactggcccccgatggccgcacctttgtg
tctggtgcctgtgacgcctccatcaagctgtgggacgtgcgggattctatgtgccgacag
accttcatcggccacgagtcagacatcaatgccgtggcgttcttccccaacggctacgcc
ttcaccactggctccgatgatgccacgtgccgcctcttcgacctgcgggctgaccaggag
ctgctcatgtactcccacgacaacatcatctgcggcatcacctctgttgccttctcccgc
agcggccggctgctgctcgccggctacgacgacttcaactgcaacatctgggacgccatg
aagggcgaccgtgcaggtgtcctcgccggccacgacaaccgtgtgagctgcctcggggtc
accgatgatggcatggctgggggcccaggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system