KEGG   Ailuropoda melanoleuca (giant panda): 100484573Help
Entry
100484573         CDS       T01329                                 

Gene name
USP13
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100484573 (USP13)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100484573 (USP13)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100484573 (USP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 867 aa AA seqDB search
XXXXXXXRGALFGMPGGSGSRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSP
NSEGGLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKI
FLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRK
QDPDTWENELPVSKYANNLTQLDNGVRIPPNGWKCARCDLRENLWLNLTDGSVLCGKWFF
DSSGGNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDML
HMHGTENGLRDNDIKPRVSEWEVIQETGMKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFS
IPEFQRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEE
HKPQQNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFL
VEERIQCCQTRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVR
AKIPFSACLQAFSEPENVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVP
KKFDVSIDMPDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQLIDPSEIDES
SVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGA
SVFGATGLDNQPPEEIVAIITSMGFHRNQAVQALRATNNNLERALDWIFSHPEFEEDSDF
VIEMENNANANIISEAKPEGPRVKDGSGMYELFAFISHMGTSTMSGHYVCHIKKEGRWVI
YNDHRVCASERPPKDLGYMYFYHRVPR
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
nnnnnnnnnnnnnnnnnnnnncggggcgccctgttcggcatgccgggcggcagcggcagc
aggaagatggctgcaggagacatcggcgagctgctggtgcctcacatgcccacgatccgc
gtgcccaggtcgggggacagggtgtacaagaacgagtgcgccttctcgtacgactccccc
aattctgaaggtggactctatgtatgcatgaatacatttttggcctttggaagggaacat
gttgaaagacattttcgaaaaactggacagagtgtatacatgcacctgaaaagacacgtg
cgagagaaggtaagaggggcatctggtggagctttaccgaaaaggaggaattccaagatt
tttttagatctagatactgatgacgatttaaatagcgacgattatgaatatgaagatgaa
gccaaacttgttatattcccagaccactatgaaatagcactaccaaatattgaggagtta
ccagccctggtaacaattgcttgtgatgcggttctcagctcaaaatctccatatagaaag
caggacccagacacatgggaaaatgaattgccagtatccaaatacgccaataaccttacc
cagttggacaatggagtcaggattcctccaaatggttggaagtgtgccaggtgtgacctg
cgggaaaacctctggttgaatctgaccgatggctccgtgctgtgtgggaagtggttcttt
gacagctctggaggcaacgggcacgcactggagcattacagagacatgggctaccctcta
gccgtgaagctgggaaccatcacccctgatggggcagatgtttattcttttcaagaagaa
gaaccggttttggatcctcatttggccaagcacttagcacattttggaattgatatgctt
catatgcatgggacagagaacgggcttcgggacaatgacatcaagcctcgggtcagcgag
tgggaagtgatccaggagacagggatgaagctgaaacccatgtatggccccgggtacacg
gggctcaagaatctgggcaacagctgctacctgagttccgtcatgcaggccatcttcagc
atcccagaattccagagagcgtatgtagggaatcttccaagaatatttgactactctcct
ttagatccaacacaggacttcaacacacagatgactaagttaggacatggccttctctcg
ggccagtattcaaaacctccagtgaaatctgaactcattgaacaggtgatgaaggaggaa
cacaagcctcaacagaatgggatctctccacgcatgtttaaggcctttgtaagcaagagc
caccccgaattctcctctaatagacagcaggatgcccaggagtttttcttgcacctggtg
aatctagtagagaggaaccgcattggctcagaaaacccaagtgatgtttttcggtttttg
gtggaagaacgtattcagtgctgtcagacgcgcaaagttcgctacacggagagggtggat
tacctgatgcagttacctgtggccatggaggcggcaaccaacaaggatgagctgattgcc
tatgagttaacgagaagggaagcggaagcaaacagaagaccccttcccgagttggttcgt
gccaagataccctttagtgcctgccttcaggccttttctgaaccagagaacgtagatgat
ttctggagcagcgccctacaagcaaagtctgcgggtgtgaaaacatctcgctttgcctca
ttccctgaatacttggtagtgcagataaagaagttcacttttggtcttgactgggttccc
aaaaaatttgatgtttctattgatatgccagacctacttgatatcaaccatctccgagcc
agggggttacagccaggagaggaggagcttccggacatcagcccccctatagtcattccc
gatgactcaaaagatcgcctgatgaatcaactgatagacccctcagaaattgatgagtca
tcagtgatgcagctggccgagatgggtttccccctagaagcgtgtcggaaggctgtgtac
tttactggaaatatgggagctgaagtggccttcaactggatcatcgttcacatggaagag
ccagattttgccgaaccgctgaccatgcctggttatggaggagcagcttctgctggagcc
tctgtttttggtgctactggactggataaccaacccccggaggaaattgtagctatcatt
acctccatgggattccatcgaaatcaggctgttcaggcgctgcgagccacgaataataac
ctggaaagagcactggattggatctttagtcaccctgagtttgaggaggacagtgacttt
gtgattgagatggagaataacgccaatgcaaacattatttctgaggccaagcctgaagga
cctagagtcaaagatggatctggaatgtatgaattatttgcattcatcagtcacatggga
acatctacaatgagtggccattatgtttgccatattaaaaaggaaggaagatgggtgatc
tacaatgaccacagagtgtgtgcctcagagaggccccccaaggacctgggctacatgtac
ttttaccacagggtgccacgctga

DBGET integrated database retrieval system