KEGG   Ailuropoda melanoleuca (giant panda): 100484573Help
Entry
100484573         CDS       T01329                                 

Gene name
USP13
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 867 aa AA seqDB search
XXXXXXXRGALFGMPGGSGSRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSP
NSEGGLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKI
FLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRK
QDPDTWENELPVSKYANNLTQLDNGVRIPPNGWKCARCDLRENLWLNLTDGSVLCGKWFF
DSSGGNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDML
HMHGTENGLRDNDIKPRVSEWEVIQETGMKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFS
IPEFQRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEE
HKPQQNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFL
VEERIQCCQTRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVR
AKIPFSACLQAFSEPENVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVP
KKFDVSIDMPDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQLIDPSEIDES
SVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGA
SVFGATGLDNQPPEEIVAIITSMGFHRNQAVQALRATNNNLERALDWIFSHPEFEEDSDF
VIEMENNANANIISEAKPEGPRVKDGSGMYELFAFISHMGTSTMSGHYVCHIKKEGRWVI
YNDHRVCASERPPKDLGYMYFYHRVPR
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
nnnnnnnnnnnnnnnnnnnnncggggcgccctgttcggcatgccgggcggcagcggcagc
aggaagatggctgcaggagacatcggcgagctgctggtgcctcacatgcccacgatccgc
gtgcccaggtcgggggacagggtgtacaagaacgagtgcgccttctcgtacgactccccc
aattctgaaggtggactctatgtatgcatgaatacatttttggcctttggaagggaacat
gttgaaagacattttcgaaaaactggacagagtgtatacatgcacctgaaaagacacgtg
cgagagaaggtaagaggggcatctggtggagctttaccgaaaaggaggaattccaagatt
tttttagatctagatactgatgacgatttaaatagcgacgattatgaatatgaagatgaa
gccaaacttgttatattcccagaccactatgaaatagcactaccaaatattgaggagtta
ccagccctggtaacaattgcttgtgatgcggttctcagctcaaaatctccatatagaaag
caggacccagacacatgggaaaatgaattgccagtatccaaatacgccaataaccttacc
cagttggacaatggagtcaggattcctccaaatggttggaagtgtgccaggtgtgacctg
cgggaaaacctctggttgaatctgaccgatggctccgtgctgtgtgggaagtggttcttt
gacagctctggaggcaacgggcacgcactggagcattacagagacatgggctaccctcta
gccgtgaagctgggaaccatcacccctgatggggcagatgtttattcttttcaagaagaa
gaaccggttttggatcctcatttggccaagcacttagcacattttggaattgatatgctt
catatgcatgggacagagaacgggcttcgggacaatgacatcaagcctcgggtcagcgag
tgggaagtgatccaggagacagggatgaagctgaaacccatgtatggccccgggtacacg
gggctcaagaatctgggcaacagctgctacctgagttccgtcatgcaggccatcttcagc
atcccagaattccagagagcgtatgtagggaatcttccaagaatatttgactactctcct
ttagatccaacacaggacttcaacacacagatgactaagttaggacatggccttctctcg
ggccagtattcaaaacctccagtgaaatctgaactcattgaacaggtgatgaaggaggaa
cacaagcctcaacagaatgggatctctccacgcatgtttaaggcctttgtaagcaagagc
caccccgaattctcctctaatagacagcaggatgcccaggagtttttcttgcacctggtg
aatctagtagagaggaaccgcattggctcagaaaacccaagtgatgtttttcggtttttg
gtggaagaacgtattcagtgctgtcagacgcgcaaagttcgctacacggagagggtggat
tacctgatgcagttacctgtggccatggaggcggcaaccaacaaggatgagctgattgcc
tatgagttaacgagaagggaagcggaagcaaacagaagaccccttcccgagttggttcgt
gccaagataccctttagtgcctgccttcaggccttttctgaaccagagaacgtagatgat
ttctggagcagcgccctacaagcaaagtctgcgggtgtgaaaacatctcgctttgcctca
ttccctgaatacttggtagtgcagataaagaagttcacttttggtcttgactgggttccc
aaaaaatttgatgtttctattgatatgccagacctacttgatatcaaccatctccgagcc
agggggttacagccaggagaggaggagcttccggacatcagcccccctatagtcattccc
gatgactcaaaagatcgcctgatgaatcaactgatagacccctcagaaattgatgagtca
tcagtgatgcagctggccgagatgggtttccccctagaagcgtgtcggaaggctgtgtac
tttactggaaatatgggagctgaagtggccttcaactggatcatcgttcacatggaagag
ccagattttgccgaaccgctgaccatgcctggttatggaggagcagcttctgctggagcc
tctgtttttggtgctactggactggataaccaacccccggaggaaattgtagctatcatt
acctccatgggattccatcgaaatcaggctgttcaggcgctgcgagccacgaataataac
ctggaaagagcactggattggatctttagtcaccctgagtttgaggaggacagtgacttt
gtgattgagatggagaataacgccaatgcaaacattatttctgaggccaagcctgaagga
cctagagtcaaagatggatctggaatgtatgaattatttgcattcatcagtcacatggga
acatctacaatgagtggccattatgtttgccatattaaaaaggaaggaagatgggtgatc
tacaatgaccacagagtgtgtgcctcagagaggccccccaaggacctgggctacatgtac
ttttaccacagggtgccacgctga

DBGET integrated database retrieval system