KEGG   Ailuropoda melanoleuca (giant panda): 100484833Help
Entry
100484833         CDS       T01329                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100484833
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100484833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 322 aa AA seqDB search
MAASGEPGRQWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCV
QAARLGAKTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTQDAATGTASIIVNNEGQNI
IVIVAGANLLLNTEDLREAARTISRAKVMLCQLEITPEASLEALTMAHSNGVKTLFNPAP
AVAGLDPRFYTLSDVFCCNETEAEILTGLAVGSPADAGQAALVLMERGCHVVIVTLGAEG
CVMLSQTEPVPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEEMLKRSNFIAAV
SVQAAGTQSSYPYKKDLPLDLF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggccgcatctggggaacccggccggcagtggcaggaggaggtggccgcggtggtagtg
gtgggctcctgcatgaccgacctggtcagtcttacttctcgtttgccaaaaaccggagaa
accatccatggacataagttttttattggctttggagggaaaggtgccaaccagtgtgtc
caagctgccaggcttggagcaaagacatccatggtatgcaaggttggcaaagattctttt
ggcaatgattatatagaaaacttaaaacagaacgatatttctacagaatttacatatcag
actcaagatgctgctacaggaactgcttctataattgtcaataacgaaggccagaatatc
atcgttatagtggctggagcaaatttacttttgaatactgaagacctgagggaagcagcc
aggaccattagcagagccaaagtcatgctctgccagttagaaataactccagaagcatct
ttggaagccctgacgatggcccacagcaatggagtgaagacattgttcaatccagctcct
gcagttgctggcctggaccctcgcttctacaccctctcagatgtgttctgctgcaatgaa
accgaggctgagatcctaactggcctggcggtcggcagccctgcagacgccgggcaggct
gcgctcgtgctcatggaaaggggctgccacgtggtcattgtcaccttaggtgctgaagga
tgtgtgatgctgtcacagacagaacccgtgccaaagcacattcccaccgagaaagtcaag
gctgtggataccacgggcgctggtgacagttttgtgggggctttggccttctacctggct
tactacccaaatctgtccttggaagaaatgctcaagagatccaatttcatcgcagcagtc
agtgtccaggctgcaggaacacagtcatcgtatccatacaaaaaagacctgccacttgat
ctgttttga

DBGET integrated database retrieval system