KEGG   Ailuropoda melanoleuca (giant panda): 100484886Help
Entry
100484886         CDS       T01329                                 

Gene name
UCHL1
Definition
(RefSeq) ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
  KO
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    100484886 (UCHL1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100484886 (UCHL1)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100484886 (UCHL1)
Ubiquitin system [BR:aml04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    100484886 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 224 aa AA seqDB search
MQLKPMEINPEMLNKVLARLGVAGQWRFADVLGGLEEEALGSVPAPACALLLLFPLTAQH
ENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLS
ETEKLSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRM
PFPVNHGASSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaaaccgatggagattaaccccgagatgctgaacaaagtgctggcccggctg
ggggtcgccggccagtggcgcttcgcggacgtgctgggggggctggaggaggaggctctg
ggctcggtgccagcgcctgcctgcgcgctgctgctgctgtttcccctcacggcccagcat
gagaacttcaggaaaaaacagattgaagagctgaagggacaagaagtcagtcctaaggtg
tacttcatgaagcagaccattggcaactcctgtggcaccatcgggcttatccacgcagtg
gccaataaccaggacaaactggagtttgaggatgggtcagtcctgaaacagtttctttct
gaaacggagaagctgtcccctgaagaccgagccaaatgctttgaaaagaacgaggccatt
caggcagcccatgatgccgtggcacaggagggccagtgtcgggtagatgacaaagtgaat
tttcattttattctgtttaacaacgtggatggccatctctatgaacttgatggaagaatg
cctttcccagtaaaccatggtgccagctcagaggactccttgctgcaggatgccgccaag
gtctgcagagaattcaccgagcgtgagcaaggggaggtccgcttttctgctgtggcactc
tgcaaggcagcctaa

DBGET integrated database retrieval system