KEGG   Ailuropoda melanoleuca (giant panda): 100484967Help
Entry
100484967         CDS       T01329                                 

Gene name
HEXDC
Definition
(RefSeq) hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
  KO
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100484967 (HEXDC)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100484967 (HEXDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 484 aa AA seqDB search
MKNSEMSGSSPFKMRLVHLDLKGAPPKVSYLSEVFPLFHALGANGLLLEYEDMFPYEGHL
RLLRAKHAYSPPEIKEILHLATLNELEVIPLVQTFGHMEFVLKHKALAHLREVALFPNTL
NPHEAESLALVGAMISQVMELHPGARWLHVGCDEVYYLGEGEASRQWLQQEHNTKARLCL
SHIKAVACHVLARHPTTRPLVWDDMLRAIPEDQLSASGVPQLVEPVLWDYGADLDIHGKA
LLMEKYRKCGFLRLWAASAFKGATGASQALTPTEHHLRNNMQWLQVAASGPSDMLQGIVL
TGWQRYDHFSVLCELLPVGIPSLAVCLQSLLHGGFAEGVKAKVENFLGISNLEITDFISE
GAGTFPGSDILALVTHVSLHLRSSVDTLLERDRYVTGWFSPYHRRQKLIHPVMVQHIQPQ
ALSLLARWSTWAQQLEAALHRVFYPDAVEEWLEENVQPSLRRLQGLLQDLREAVSPSPHA
GQDP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagtgaaatgtcaggttcttcaccatttaagatgcgattagttcatttggac
cttaaaggagctccaccaaaggtttcctatctctctgaggtctttcctctgttccacgcc
ctgggcgccaacgggctcctcctcgagtatgaagacatgtttccctacgagggccacctc
aggctgctgagagccaagcacgcatacagcccccctgaaatcaaagagatcctacatctg
gctacactgaacgagctagaggtcattccattggtgcagacatttggacacatggagttt
gtgctgaagcacaaggctctcgctcacctccgagaagtggcactcttccctaacaccctg
aacccccatgaggcggagtccctggcgctggtgggagccatgatcagccaggtcatggag
ctgcacccgggcgcccggtggctccatgtcggctgtgacgaggtctattaccttggagag
ggcgaggcctcaagacagtggctgcagcaggagcataacaccaaagcaaggctgtgtctg
tcccacataaaggcggtggcctgccacgtgctggcccggcaccccaccacgaggcccctg
gtgtgggacgacatgctgcgggccatccccgaggaccagctctcagcatcgggggtgccg
cagctggtggagcctgtgctctgggactacggggctgacctggacatccacggcaaagct
cttctcatggaaaagtaccgaaagtgtggctttctccggctgtgggctgccagcgccttc
aagggggccacaggggcgagccaggccctgacccccactgagcaccacctcaggaacaac
atgcagtggctgcaggtggcggccagtgggccctcggacatgctgcagggcatcgtcctc
actggctggcagaggtacgaccacttctccgtgctgtgcgagttgctgcccgtgggaatc
ccatccctggccgtctgcctgcagtcgctcctacacggaggttttgctgaaggtgttaaa
gcaaaagtggagaactttctcgggatttcaaacctagaaataactgattttataagtgag
ggggccggcaccttccctggcagcgacatcctggccctcgtcacgcacgtcagcctccac
ctgcgcagctccgtggacacgcttctggagagggacaggtacgtgacgggctggttcagc
ccctaccaccgcaggcagaagctcatccacccggtcatggtccagcacatccagccccag
gcgctcagcctcctggccaggtggagcacctgggcgcagcagctggaggccgccctgcat
cgtgtcttctatcccgacgccgtggaggagtggctggaggagaacgtgcagcccagcctg
aggcggctacagggtttgctgcaggacctcagagaggcagtcagccccagcccacacgcg
ggtcaggacccctga

DBGET integrated database retrieval system