KEGG   Amycolatopsis mediterranei S699: AMES_0412Help
Entry
AMES_0412         CDS       T02190                                 

Gene name
dcyD
Definition
1-aminocyclopropane-1-carboxylate deaminase
Organism
amm  Amycolatopsis mediterranei S699
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
428772..429800
Genome map
AA seq 342 aa AA seqDB search
MTFDFAGFPDAALAAVPRVDLGGWPTPLHGAPRLGEALGLRNLWLKRDDVHPLGAGGNKL
RKLEYHLGAAEKAGADTVITFGALQTNHGRQTAAACAKLGLRCELVLTAKVPRDGEAYER
GGNLPLDRLFGATVHICADGEETGRTYDRLVAEAAADGRKVATIPVGGSNDLGALGYVRA
TYELAKQLEERGIERAHLVVPHASGGTAAGVALGTALLGNLGVGIACVSHPLDEATENLR
DLVDGAAKLLGVEPPSLTHTRMGDSTLGPGYGIPTDAVWNALRLFGRTEGVVLDPVYTGK
VAAALVEWAGHFAPDDHVVFLHTGGMPGLYGYAPEFAAAVEG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgacttcgccggattccccgacgccgcgctggccgcggtaccccgcgtcgac
ctgggcggctggccgacgccgctgcacggggccccccggctcggcgaagccctcggcctg
cggaacctctggctcaagcgcgacgacgtgcacccgctcggcgccggcggcaacaagctc
cgcaagctggagtaccacctcggcgcggcggaaaaagccggtgcggacaccgtgatcacc
ttcggggcgctccagaccaaccacggccgtcagaccgccgccgcgtgcgcgaagctcggc
ctgcgctgcgagctcgtgctcacggccaaggtcccgcgcgacggcgaggcgtacgaacgc
ggcggcaacctgcccctcgaccggcttttcggcgcgaccgtccacatctgcgccgacggc
gaggaaaccggccgcacctacgaccgcctggtcgccgaagccgccgccgacggccggaag
gtcgccacgatcccggtcggcggctccaacgacctcggcgccctcgggtacgtccgcgcc
acctacgaactcgcgaaacagctggaagagcgcggcatcgagcgggcacacctcgtcgtc
ccgcacgccagcggcggcaccgcggccggcgtcgcgctgggcaccgcgctcctaggcaac
ctcggcgtcggcatcgcctgcgtcagccacccgctcgacgaggccacggagaacctccgc
gacctcgtcgacggcgcggccaagctcctcggcgtcgaaccaccgtcgctcacgcacacg
aggatgggcgattccacgctcggccccggttacggcatcccgaccgacgcggtctggaac
gccctacggctcttcggtcgcaccgagggcgtggtgctcgacccggtctacaccggcaag
gtggccgccgcgctggtcgaatgggccggccacttcgccccggacgaccacgtggtgttc
ctgcacaccggcggcatgcccggcctgtacggctacgcgcccgaattcgccgcggccgtc
gaaggctga

DBGET integrated database retrieval system