KEGG   Amycolatopsis mediterranei S699: AMES_0484Help
Entry
AMES_0484         CDS       T02190                                 

Gene name
hemB
Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMES_0484 (hemB)
Enzymes [BR:amm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AMES_0484 (hemB)
Exosome [BR:amm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMES_0484 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
498242..499168
Genome map
AA seq 308 aa AA seqDB search
MRRLVGETTLRPRQLILPMFVAEGIDSPRPISSMPGVVQHTRDTLRKAAVDAVNAGVGGL
MLFGIPATRDAEGSGAVDEKGILNVALRDLRHELGDATVLMADTCLDEFTDHGHCGVLDA
DGGVDNDATLRIYAQMAIAQVEAGAHVLGPSGMMDGQIGVIRRALDEVGHKEAAILAYSA
KYASAFYGPFREAVDSQLKGDRKTYQQDPGNGREALREIELDLAEGADMIMVKPALAYLD
VIKAAADISPVPVAAYNISGEYAMVEAAAANGWLDRERTVLEVLTSIRRAGADLILSYWA
AEAAAWLD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggctggtgggcgaaacgacgctgcggccacgccagctgatcctcccgatgttc
gtcgccgaagggatcgactcgccgcggccgatttcgagcatgcccggcgtcgtccagcac
acccgcgacacgctgcggaaggccgccgtcgacgcggtcaacgccggcgtcggtggcctc
atgctgttcggcatcccggccacgcgcgacgccgagggctccggagccgtcgacgaaaag
ggcatcctcaacgtggccctgcgcgacctccgccacgagctgggtgacgccaccgtgctg
atggccgacacctgcctcgacgagttcaccgaccacggccactgcggcgtcctcgacgcc
gacggcggggtcgacaacgacgccaccctgcggatctacgcccagatggccatcgcgcag
gtcgaagccggggcgcacgtgctcgggccgtccgggatgatggacggccagatcggtgtc
atccgccgggcgctcgacgaggtcgggcacaaggaggcggcgatcctggcgtactccgcg
aagtacgccagcgcgttctacggccccttccgcgaggccgtcgactcgcagctcaagggc
gaccgcaagacctaccagcaggacccgggcaacggccgcgaggcgctgcgcgagatcgag
ctggacctcgccgagggcgcggacatgatcatggtcaagcccgcgctggcctacctggac
gtcatcaaggcggccgcggacatctccccggtgccggtggcggcctacaacatctcgggc
gagtacgcgatggtcgaggccgcggcggcgaacggctggctggaccgcgagcggacggtt
ctcgaggtgctgacgtcgatccgccgcgcgggcgccgacctgatcctgagctactgggcc
gcggaggccgctgcctggctggactga

DBGET integrated database retrieval system