KEGG   Amycolatopsis mediterranei S699: AMES_0540Help
Entry
AMES_0540         CDS       T02190                                 

Gene name
paaG
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AMES_0540 (paaG)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMES_0540 (paaG)
   00650 Butanoate metabolism
    AMES_0540 (paaG)
  Lipid metabolism
   00071 Fatty acid degradation
    AMES_0540 (paaG)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMES_0540 (paaG)
   00310 Lysine degradation
    AMES_0540 (paaG)
   00360 Phenylalanine metabolism
    AMES_0540 (paaG)
   00380 Tryptophan metabolism
    AMES_0540 (paaG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMES_0540 (paaG)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMES_0540 (paaG)
   00281 Geraniol degradation
    AMES_0540 (paaG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMES_0540 (paaG)
   00627 Aminobenzoate degradation
    AMES_0540 (paaG)
   00930 Caprolactam degradation
    AMES_0540 (paaG)
Enzymes [BR:amm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMES_0540 (paaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(555624..556388)
Genome map
AA seq 254 aa AA seqDB search
MTDRIVSEHSGGVALLTVDAPASRNALTLDLSAQLAAAVEAAERDESVHAVVVTGTPPVF
CAGADLSALAAADEPGLRAIYEGFLAVARCELPTIAAVGGAAVGAGLNLALAADVRLAGP
RAKFVARFLELGLHPGGGMTWMTQRLAGPQQAAAMTLFGQPLDAEAAVRAGLALRVVDGG
HDELLTAARELAHPAVAAPREALVATKRSLRATASLAEHSAAVDVEIRPQLASLASPEFA
QRLSLLQDRIRSRP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcatcgtcagcgagcactccggcggcgtcgccctgctgaccgtcgacgcg
cccgccagccggaacgcgctgacgctcgacctctccgcgcagctcgccgccgccgtcgag
gccgcggagcgggacgagtccgtgcacgccgtcgtggtcaccgggacgccgcccgtcttc
tgcgccggcgccgacctgtccgcgctcgccgcggccgacgagcccggcttgcgggccatc
tacgaaggcttcctcgccgtcgcgcggtgcgagctgccgaccatcgccgcggtcggaggt
gccgccgtcggggccgggctgaacctcgccctcgccgccgacgtccggctggccgggccg
cgggcgaagttcgtcgcccggttcctcgagctcgggctgcacccgggcggcgggatgacc
tggatgacgcagcggctcgccggcccgcagcaggccgccgccatgacgttgttcgggcag
ccgctcgacgccgaagccgcggtgcgcgccgggctggcgctgcgcgtggtcgacggcggc
catgacgaactactgaccgcggcgcgtgagctcgctcaccccgcggtggccgcgccgcgc
gaagcactggtcgccaccaagcgcagtctccgcgccaccgcgagcctggccgagcacagt
gccgccgtcgacgtcgagatccggccgcagctggcctcgctggcgtcaccggagttcgcc
cagcggctttccctgctgcaggaccggatccgttctcggccgtga

DBGET integrated database retrieval system