KEGG   Amycolatopsis mediterranei S699: AMES_0773Help
Entry
AMES_0773         CDS       T02190                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:amm00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
839373..841085
Genome map
AA seq 570 aa AA seqDB search
MTASNTTTSAGGPDYDVVVVGSGFGGSVAALRLTEKGYRVAVVEAGRRFADDEFAKTSWD
LKRYLWAPQVGCYGIQRIHMLNDVMVLAGAGVGGGSLVYANTLYRPLRPFYRDRQWAHIT
DWESELAPHYDQASRMLGVVTNPTITPSDVVMREVAKDMGVADSFHPTPVGVYFGKPGER
AADPYFGGAGPARTGCTECGSCMTGCRVGAKNTLVKNYLYLAEQDGAQVIPLTTVTAVTP
IDGGYEISLKKTGTTSKKFRTTITAEKVVFAAGTWGTQNLLHRMKDTGRLPQLSRRLGEL
TRTNSEAIIGAARTDVDESRNFSRGVAITSSIHPDENTHIEPVRYGKGSNAMSLLQTIAT
DGASPVPRWRQAVTFMLKHPVQAAKLLNGYRWSERTVILLVMQSLDNSITTYTKRGLSGR
RKYTSKQGHGEPNPSFIPAGHEANERTAEHIGGMAGGTWGEIFDIPLTAHFIGGVPIGAT
ADEGVIDPYHRVFGYPGLSVVDGAAITANLGVNPSLTITAQAERAFSFWPNKGEEDLRPA
QDVPYARLEPIAPKNPAVPAEAPAALRRSS
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccagtaacaccaccaccagcgcgggtggccccgactacgacgtcgtcgtggtg
gggtcggggttcggcggcagcgttgcggcgctgcggctcaccgagaagggctaccgggtc
gccgtcgtcgaggcgggccgccggttcgccgacgacgagttcgcgaagacgtcgtgggac
ctcaagcgctacctctgggcaccgcaggtcggctgctacggcatccagcgcatccacatg
ctcaacgacgtcatggtgctggcgggcgccggtgtcggcggcggctcgctcgtctacgcg
aacacgctgtaccggccgctccggccgttctaccgcgaccggcagtgggcgcacatcacc
gactgggagtccgagctcgccccgcactacgaccaggcgagccgcatgctcggcgtcgtc
acgaacccgacgatcaccccgtcggacgtcgtgatgcgcgaggtcgcgaaggacatgggg
gtcgccgattcgttccacccgacgccggtcggcgtctacttcggcaagccgggcgagcgc
gccgccgatccgtacttcggcggcgccggcccggcccgcaccggctgcaccgaatgcggc
tcctgcatgaccggctgccgcgtcggcgcgaagaacacgctggtcaagaactacctctac
ctcgccgagcaggacggcgcgcaggtcatcccgctcaccacggtgaccgccgtgacgccg
atcgacggcggctacgagatctcgctcaagaagaccgggacgacctcgaagaagttccgc
acgacgatcacggccgaaaaggtcgtcttcgccgcggggacctggggcacccagaacctg
ctgcaccggatgaaggacaccggacggctgccgcagctctcgcggcggctcggcgagctg
acccgcacgaactccgaggccatcatcggcgcggcccggaccgacgtcgacgagagccgg
aacttcagccgcggcgtcgcgatcacctcgtcgatccacccggacgaaaacacccacatc
gagccggtccgctacggcaagggcagcaacgcgatgagcctgctgcagacgatcgcgacc
gacggcgcctcgccggtgccgcgctggcggcaggccgtcacgttcatgctcaagcacccg
gtccaggccgcgaagctgctcaacggctaccgctggagcgagcgcacggtgatcctgctg
gtgatgcagagcctggacaactcgatcaccacctacaccaagcgcgggctgtccggccgc
cgcaagtacacgtccaagcagggccacggcgaaccgaacccgagcttcatcccggccggt
cacgaggccaacgagcgcacggccgagcacatcggcggcatggcgggcggcacctggggc
gagatcttcgacatcccgctgacggcgcacttcatcggcggcgtcccgatcggcgcgacg
gccgacgagggcgtgatcgacccgtaccaccgcgtgttcggctacccgggcctgtcggtg
gtggacggcgccgcgatcaccgccaacctcggcgtgaacccgtcgctgacgatcaccgcc
caggccgagcgtgcgttctccttctggccgaacaagggcgaggaggacctgcgcccggcg
caggacgtgccctacgcgcggctggagccgatcgcgccgaagaacccggccgtcccggcc
gaagcccccgccgccctgcgtcgttcctcctag

DBGET integrated database retrieval system