KEGG   Amycolatopsis mediterranei S699: AMES_0800Help
Entry
AMES_0800         CDS       T02190                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00020  Citrate cycle (TCA cycle)
amm00640  Propanoate metabolism
amm00660  C5-Branched dibasic acid metabolism
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01120  Microbial metabolism in diverse environments
amm01130  Biosynthesis of antibiotics
amm01200  Carbon metabolism
Module
amm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMES_0800 (sucC)
   00640 Propanoate metabolism
    AMES_0800 (sucC)
   00660 C5-Branched dibasic acid metabolism
    AMES_0800 (sucC)
Enzymes [BR:amm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AMES_0800 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 GARS_A ATP-grasp ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AFO74336
UniProt: G0FZI9
Position
869279..870448
Genome map
AA seq 389 aa AA seqDB search
MDLYEYQARDLFAAHGVPVLPGSVASTPEEAKAAAEHIGNQVVVKAQVKVGGRGKAGGVK
LAQTPDEAKEKAEAILGLDIKGHITRRVLVAEASDIASEYYFSFLLDRSNRTFLAMASSE
GGMEIEQLAVERPEALAKIPVDSITGVDKAKALEILKAGNFPADIIDEAADVVVKLWETF
VSEDATLVEVNPLVRDPQDKIIALDGKVTLDENADFRQPGHEALVDKDAENPLEAKAKAK
NLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDTDVKSVFVNVFGGITACDAVANGIVEALKILGDEATKPLVVRLDGNNVVEGRQIL
ADANHPLVTVVDTMDNAADKAAELAAAGA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggacctctacgagtaccaggcgagggatctcttcgccgcccacggagtaccggttctg
ccgggctcggtggctagcacccccgaagaagccaaggccgccgcggagcacatcggtaac
caggtcgtcgtcaaggcgcaggtgaaggtcggcggccgtgggaaggcgggcggcgtcaag
ctggcccagaccccggacgaggcgaaggagaaggcggaagccatcctcggcctcgacatc
aagggtcacatcacgcgtcgcgtgctcgtggccgaagcctcggacatcgcgtccgagtac
tacttctccttcctgctggaccggtccaaccggaccttcctggcgatggcgtcctccgag
ggcggcatggagatcgagcagctcgccgtcgagcgccccgaggcgctcgccaagatcccg
gtcgactcgatcaccggtgtcgacaaggcgaaggcgctcgagatcctgaaggccggcaac
ttcccggccgacatcatcgacgaagccgccgacgtcgtggtgaagctctgggagaccttc
gtctccgaggacgccaccctggtcgaggtcaacccgctggtccgtgacccgcaggacaag
atcatcgccctcgacggcaaggtcaccctcgacgagaacgcggacttccgccagccgggc
cacgaggccctggtggacaaggacgcggagaacccgctcgaggcgaaggccaaggccaag
aacctcaactacgtcaagctcgacggccaggtcggcatcatcggcaacggcgcgggcctc
gtgatgtccactttggacgtcgtggcgtacgcgggcgagaagcacggcggcgtgaagccg
gcgaacttcctcgacatcggcggcggcgcgtcggccgaggtcatggcggccgggctggac
gtcatcctcaacgacaccgacgtgaagagcgtcttcgtcaacgtcttcggcggcatcacc
gcctgcgacgcggtggcgaacggcatcgtcgaggccctgaagatcctgggcgacgaggcc
accaagccgctggtcgtccgcctggacggcaacaacgtcgtcgagggtcgccagatcctc
gcggacgcgaaccacccgctggtcaccgtggtggacacaatggacaacgcggccgacaag
gctgccgagctcgccgcggcaggtgcgtga

DBGET integrated database retrieval system