KEGG   Amycolatopsis mediterranei S699: AMES_0849Help
Entry
AMES_0849         CDS       T02190                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00020  Citrate cycle (TCA cycle)
amm00190  Oxidative phosphorylation
amm00650  Butanoate metabolism
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01120  Microbial metabolism in diverse environments
amm01130  Biosynthesis of antibiotics
amm01200  Carbon metabolism
Module
amm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMES_0849 (sdhD)
   00650 Butanoate metabolism
    AMES_0849 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    AMES_0849 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Ninjurin Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AFO74385
UniProt: G0FZN8
Position
complement(917048..917461)
Genome map
AA seq 137 aa AA seqDB search
MADLALANPRAPKRPAARRSNFELYSWLFMRISGLVLVILVLGHLLIMNILDGGVHRINW
GFVAGRWASPFWQFWDLLMLWLAEIHGGNGLRTIIDDYARKDSTRFWLKILLYVSMVLIL
AVGTMVIFTFDPNMPAN
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctcgccctcgcgaacccgcgcgcgccgaagcgcccggccgcgcgccggagc
aacttcgagctctacagctggctgttcatgcggatctccgggctggtcctggtcatcctg
gtgctcggccacctgctgatcatgaacatcctcgacggcggcgtgcaccggatcaactgg
ggcttcgtcgccggccgctgggcctcgccgttctggcagttctgggacctgctgatgctg
tggctcgccgagatccacggcggcaacgggctgcgcacgatcatcgacgactacgcccgc
aaggacagcacgcggttctggctgaagatcctgctgtacgtctcgatggtgctgatcctg
gccgtcggcacgatggtgatcttcacgttcgacccgaacatgcccgcgaactaa

DBGET integrated database retrieval system