KEGG   Amycolatopsis mediterranei S699: AMES_0858Help
Entry
AMES_0858         CDS       T02190                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00240  Pyrimidine metabolism
amm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AMES_0858 (deoA)
Enzymes [BR:amm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     AMES_0858 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: AFO74394
UniProt: G0FZP7
Position
927978..929255
Genome map
AA seq 425 aa AA seqDB search
MSAFAAVDVIRTKRDGGTLSDEQIDWVVDAYTRGDVAEEQMSALAMAIFLRGMTSAEISR
WTHAMIASGERLSLSVSRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTG
GTLDKLESIPGWRAALSTSEIQSQLEDVGAVVCAATSGLAPADKKLYALRDVTSTVESIP
LIASSIMSKKIAEGASGLVLDVKFGSGAFMKSLDQARSLASALTSIGADHGVPTTALLTD
MNVPLGRAVGNAVEVAESVDVLKGGGPADVVALTVALAREMLALAGLDVDPAAVLASGEA
YEVWCRMIAAQGGDPSAPLPTPSHVHVVTAPSSGVLASLDAYAVGVAAWRLGAGRARKED
PVQAAAGILCLAKPGDAVSEGDPLLELHTDTPDAVPAALSALEGGFTIASSAPEPGPIVV
ETIRS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgttcgcggcggtcgacgtcatccggaccaagcgggacggcggcacgctttcc
gacgagcagatcgactgggtcgtcgacgcctacacccggggtgacgtcgccgaagagcag
atgtcggcgctggccatggcgatcttcctgcgcgggatgacctcggccgagatctcccgg
tggacgcacgcgatgatcgcgtcgggggagcggctgtcgctttcggtgtcccggccgacg
gtggacaagcactcgacgggcggggtcggcgacaagatcacgctgccgctggcgccgctg
gtggcggcgtgcggcgcggccgtgccacagctgtccggccgcgggctcggccacaccggc
gggacgctcgacaagctggagtcgattcccggctggcgcgccgcactgtccacttcggag
attcaatcgcagctggaggacgtcggcgcggtggtctgcgcggcgacgtccgggctggcg
ccggcggacaagaagctgtacgcgctgcgggacgtcacgtccactgtggagtcgatcccg
ctgatcgccagctcgatcatgagcaagaagatcgccgaaggcgcgtccgggctggtcctg
gacgtgaagttcgggtcgggcgcgttcatgaagtcgcttgaccaggctcgttcgctggct
tccgcgttgacctcgatcggcgccgatcacggtgtcccgacgacggcgttgctgaccgac
atgaacgtcccgctggggcgggcggtcggcaacgcggtggaggtcgcggagtcggtcgac
gtgctcaaaggcggcggtccggcggacgtggtcgcgctgactgtggccctggcccgggag
atgctggcgctggccggcctcgacgtcgacccggcggcggtgctggcttcgggcgaggcg
tacgaggtctggtgccggatgatcgcggcccagggcggcgacccgtcggcgccgctgccg
acgccctctcacgtccacgtggtcacggcgccttcttcgggggtgctggcttcgctggac
gcgtacgcggtgggcgtcgcggcgtggcggctcggtgcgggccgcgcccgcaaggaggac
ccggtccaggccgcggcgggcatcctgtgcctggccaagccgggggacgcggtctccgag
ggcgacccgctgctggaactccacacggacacgcctgacgcggtcccggccgccctgtcc
gcgctcgagggtgggttcacgatcgcttcgtcggcgcctgaaccgggcccgatcgtcgtg
gagaccatccgtagctag

DBGET integrated database retrieval system