KEGG   Amycolatopsis mediterranei S699: AMES_0922Help
Entry
AMES_0922         CDS       T02190                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:amm00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(993273..994787)
Genome map
AA seq 504 aa AA seqDB search
MTSYVAAIDQGTTSTRCMIFNHEGRVVSVDQREHEQIFPRAGWVEHNAEEIWENTRRVAA
GALAKADLTAKDIAAVGITNQRETALVWDKTTGRPVYNAIVWQDTRTDKIVTELGNLGGG
QERYRDKVGLPLATYFSGPKIKWILDNVEGAREKAEAGDLIFGNMDTWVLWNMTGGTDGG
VHVTDPTNASRTMLMDLDTLQWDDGIAGEMGIPLSMLPEIRSSSEEYGKVREKGALAGVP
IAGILGDQQAATFGQACLSPGEAKNTYGTGNFMLLNTGTEKVMSQNGLLTTVCYKIGSND
TIYALEGSIAVTGSLVQWLRDNLGMIATAAEIEEHARSVEDNGGAYFVPAFSGLFAPYWR
SDARGAIVGLTRFVNKGHLARAVLEATAFQSREVIDAMNADSGVPLKSLKVDGGMVVNEL
LMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWKSEDDIRTNWAQDKQWDPGMDDA
RREREYRNWKKAVTKTFDWVSEED
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgtacgtagccgcgatcgaccagggcacgacttccacgcggtgcatgatcttc
aaccacgagggccgggtcgtctcggtcgaccagcgcgagcacgagcagatcttcccccgc
gccggctgggtcgagcacaacgcggaagagatctgggagaacacccgccgggtcgccgcg
ggcgcgctggccaaggccgacctcaccgccaaggacatcgccgccgtcggcatcaccaac
cagcgcgaaaccgcgctcgtctgggacaagacgaccggccggccggtgtacaacgcgatc
gtctggcaggacacccgcaccgacaagatcgtcaccgagctcggcaacctcggcggcggc
caggagcgctaccgcgacaaggtcggcctcccgctcgcgacctacttctccggacccaag
atcaagtggatcctggacaacgtcgagggcgcgcgcgagaaggccgaggccggtgacttg
atcttcggcaacatggacacctgggtgctgtggaacatgaccggcggcaccgacggcggc
gtgcacgtcaccgacccgaccaacgcctcccgcaccatgctgatggatctcgacaccctg
cagtgggacgacgggatcgccggcgagatgggcatccccctttcgatgctgccggagatc
cgctcctcgtccgaggagtacggcaaggtccgcgagaagggcgcgctggccggcgtcccg
atcgcgggcatcctgggcgaccagcaggccgcgacgttcggccaggcctgcctctcgccc
ggcgaggccaagaacacctacggcaccggcaacttcatgctgctcaacaccggtaccgaa
aaggtgatgtcgcagaacgggctgctcaccacggtctgctacaagatcggctcgaacgac
acgatctacgcgctggaaggctccatcgccgtcaccggttcgctggtgcagtggctgcgc
gacaacctcggcatgatcgcgaccgcggccgagatcgaggagcacgcgcgcagcgtcgag
gacaacggcggcgcgtacttcgtcccggcgttctcgggcctgttcgctccttactggcga
tccgacgctcgcggcgcgatcgtcgggctcacccggttcgtcaacaagggccacctcgcc
cgcgcggtgctggaggcgaccgccttccagtcgcgcgaggtcatcgacgccatgaacgcc
gactccggagtcccgctgaagtcgctcaaggtcgacggcggcatggtcgtcaacgagctg
ctcatgcagttccaggccgacatcctcggcgtgccggtgatccgcccggtggtcaacgag
accaccgcgctgggtgccgcgtacgccgccggcctcgccgtcgggttctggaagtccgag
gacgacatccgcaccaactgggcccaggacaagcagtgggacccggggatggacgacgcc
cgccgcgagcgcgagtaccgcaactggaagaaggccgtcaccaagaccttcgactgggtc
tccgaagaggactga

DBGET integrated database retrieval system