KEGG   Amycolatopsis mediterranei S699: AMES_1382Help
Entry
AMES_1382         CDS       T02190                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
amm  Amycolatopsis mediterranei S699
Brite
Enzymes [BR:amm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     AMES_1382 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1492128..1492793
Genome map
AA seq 221 aa AA seqDB search
MLTKKRGRSRMFAGGAVLALIAAFLPGTAWADTVITTNQTGNNNGYYYSFWSAGGGSVSM
TLGSGGNYRTNWSNVNNFVAGKGWSNGSRRNVNYSGSFNPSGNSYLSLYGWTSNPLVEYY
IVDNWGSWRPTGTYKGTVTSDGGTYDIYQTTRYNAPSVEGNKTFNQYWSVRQQRRTGGTI
TTGNHFDAWGRAGMHLGSFNYYMILATEGYQSSGNSNLTVG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccaagaaacgcggccgcagcaggatgttcgccggcggcgccgtccttgcgctg
atcgccgcattcctgcccggaaccgcctgggccgacaccgtcatcacgaccaaccagacc
ggcaacaacaacgggtactactactcgttctggtccgccggtggcggctcggtctccatg
acgctcgggtccggcgggaactaccggacgaactggagcaacgtcaacaacttcgtcgcc
ggcaagggctggagcaacggcagccggcggaacgtgaactactccggcagcttcaacccc
tccggcaacagctacctgtcgctctacggctggacgtccaacccgctcgtcgagtactac
atcgtcgacaactggggcagctggcggccgaccgggacgtacaagggcaccgtgaccagc
gacggcggcacgtacgacatctaccagacgacccgctacaacgcgccgtccgtcgagggc
aacaagacgttcaaccagtactggagcgtgcgccagcagcggcggaccggcggcaccatc
accaccggcaaccacttcgacgcgtggggccgggccggcatgcacctcggcagcttcaac
tactacatgatcctcgcgaccgaggggtaccagagcagcggcaactccaacctgacggtg
ggctga

DBGET integrated database retrieval system