KEGG   Amycolatopsis mediterranei S699: AMES_1733Help
Entry
AMES_1733         CDS       T02190                                 

Gene name
galA
Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00052  Galactose metabolism
amm00561  Glycerolipid metabolism
amm00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AMES_1733 (galA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    AMES_1733 (galA)
   00600 Sphingolipid metabolism
    AMES_1733 (galA)
Enzymes [BR:amm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AMES_1733 (galA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Melibiase Melibiase_2_C
Motif
Other DBs
NCBI-ProteinID: AFO75269
UniProt: G0FPG1
Position
complement(1883903..1885120)
Genome map
AA seq 405 aa AA seqDB search
MDHGIAANRNASTGSTGLVLLLVVLTWLLSLPAATHALANGLAGTPPMGWNSWNQVRCYD
LTEDVVKQAADALADTGLRDAGYHYVVVDDCWQAPTRAADGSLQPDPKRFPHGIADLADY
VHSRGLLFGIYAVPGSRTCAMANDAYPAAGIGSLGHERQDAETFDRWGVDYLKYDWCNAD
TVDGLDRKAAFEKMRDELAALPRPIVYAISEYGVSSPWTWARPVANLWRTTYDLVPTWDS
VLATIDQQAGVAAHSGSPGGWNDPDMLQVGNGTLTADEARAHFSVWAVLNAPLFAGTDPA
KLSDTDLATLGNAEAIAVDQDFAGSQGRQLDAGPGYQVWGKPLSGGGFAVVLLNTGSTTA
TVSAAIPGAWNVRDLWAHRETGTVVGTVSSTLRPHAAALLKLTPR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttggatcacggcatcgccgcgaaccggaacgccagtaccgggagcaccgggctcgtgctc
ctgctcgtcgtgctgacctggctgctgagcctgcccgcggccacgcacgcgctcgcgaac
ggcctcgccggcaccccgccgatgggctggaacagctggaaccaggtccgctgctacgac
ctcaccgaggacgtcgtcaagcaggcggccgacgcgctcgccgacacgggcttgcgtgac
gcgggttaccactacgtcgtcgtcgacgactgctggcaggcccccacccgggcggcggac
ggctcgctgcagccggacccgaagcgcttcccgcacggcatcgccgacctcgccgactac
gtgcactcccgcggcctgctgttcggcatctacgccgtgcccggcagccggacctgcgcg
atggcgaacgacgcctacccggcggccggcatcggctcgctcggccacgagcgccaggac
gccgagacgttcgaccgctggggtgtcgactacctcaagtacgactggtgcaacgccgac
accgtcgacggcctcgaccggaaggccgcgttcgagaagatgcgcgacgaactggccgcg
ctgccccgcccgatcgtctacgcgatctccgagtacggcgtctccagcccgtggacctgg
gcgcggccggtggcgaacctctggcgcaccacttacgacctggtcccgacctgggactcg
gtgctcgcgacgatcgaccagcaggccggcgtcgccgcccacagcggctcgcccggcggc
tggaacgacccggacatgctccaggtcggcaacggcacgctgaccgccgacgaggcccgc
gcgcacttcagcgtctgggccgtgctgaacgcgccgctgttcgccggcaccgacccggcg
aagctgagcgacaccgacctcgcgacgctgggcaacgccgaggccatcgccgtcgaccag
gacttcgcgggcagccaggggcggcagctcgacgccggtcccggctaccaggtgtgggga
aaaccgctgagcggcggcggtttcgcggtggtactgctcaacaccggcagcaccaccgcg
accgtctccgcggcgatcccgggcgcgtggaacgtccgggatctgtgggcgcaccgggaa
acgggcactgtcgtcggcaccgtttcctcgaccctgcggccgcacgcggcggccttgctg
aagctcacaccgaggtga

DBGET integrated database retrieval system