KEGG   Amycolatopsis mediterranei S699: AMES_1749Help
Entry
AMES_1749         CDS       T02190                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00220  Arginine biosynthesis
amm00330  Arginine and proline metabolism
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01130  Biosynthesis of antibiotics
amm01230  Biosynthesis of amino acids
Module
amm_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    AMES_1749 (rocF)
   00330 Arginine and proline metabolism
    AMES_1749 (rocF)
Enzymes [BR:amm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AMES_1749 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFO75285
UniProt: G0FS85
Position
1902534..1903316
Genome map
AA seq 260 aa AA seqDB search
MLINAVPQRQGAVGPRAAELPDGCVALSELAGHVLGRPVHHVRQTRSVSEVDRGIAARAV
LTGANRAAQLAALEAPGGPVLTIGGDCGVELVPIGVARFRHGPGLGVAWFDAHPDLNTAD
SSPSGAFHGMVLRSLFGEGDPEFAADPALTPGNVFLAGTRAFDPEERAAVARGLVVTSVE
ALTAVEKLYVHVDLDVLDPGEFAGLNYPEPDGWTIARLVSELDALARFEVVGAGITECVG
TPREVEVLEPVLAAIGRLLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatcaacgcggtaccgcaacggcaaggcgcggtgggaccgcgcgcggcggagctg
ccggacggctgcgtggcgctctcggagctggccgggcacgtgctcggccggccggtgcac
cacgtccggcagacgcgttcggtgtccgaagtggaccgtgggatcgcggcccgtgccgtg
ctgaccggcgcgaaccgcgcggcccagctggcggccctggaggcgccgggcggcccggtg
ctgacgatcggcggtgactgcggcgtcgagctggtgccgatcggcgtggcccgcttccgc
cacgggcccgggctgggcgtcgcgtggttcgacgcccacccggacctgaacacggcggac
tcgtcgccctcgggggcgttccacggcatggtgctgcggtcgctgttcggcgagggcgac
ccggagttcgccgcggacccggccctgactccggggaacgtcttcctcgccgggacacgg
gcgttcgacccggaggaacgggcggcggtggcccgcgggctggtggtgacgtcggtcgag
gcgctgacggccgtcgaaaagctgtacgtgcacgtggatctggacgtgctggacccgggc
gagttcgcgggcttgaactacccggagccggacggctggacgatcgcgcggctggtgtcg
gaactggacgcgctggcccggttcgaggtggtcggcgcggggatcaccgagtgcgtgggg
acgccgcgtgaagtcgaggtcctggagccggtgctggcggcgatcggccgcctgctcggc
tga

DBGET integrated database retrieval system