KEGG   Amycolatopsis mediterranei S699: AMES_1749Help
Entry
AMES_1749         CDS       T02190                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMES_1749 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AMES_1749 (rocF)
Enzymes [BR:amm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AMES_1749 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1902534..1903316
Genome map
AA seq 260 aa AA seqDB search
MLINAVPQRQGAVGPRAAELPDGCVALSELAGHVLGRPVHHVRQTRSVSEVDRGIAARAV
LTGANRAAQLAALEAPGGPVLTIGGDCGVELVPIGVARFRHGPGLGVAWFDAHPDLNTAD
SSPSGAFHGMVLRSLFGEGDPEFAADPALTPGNVFLAGTRAFDPEERAAVARGLVVTSVE
ALTAVEKLYVHVDLDVLDPGEFAGLNYPEPDGWTIARLVSELDALARFEVVGAGITECVG
TPREVEVLEPVLAAIGRLLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatcaacgcggtaccgcaacggcaaggcgcggtgggaccgcgcgcggcggagctg
ccggacggctgcgtggcgctctcggagctggccgggcacgtgctcggccggccggtgcac
cacgtccggcagacgcgttcggtgtccgaagtggaccgtgggatcgcggcccgtgccgtg
ctgaccggcgcgaaccgcgcggcccagctggcggccctggaggcgccgggcggcccggtg
ctgacgatcggcggtgactgcggcgtcgagctggtgccgatcggcgtggcccgcttccgc
cacgggcccgggctgggcgtcgcgtggttcgacgcccacccggacctgaacacggcggac
tcgtcgccctcgggggcgttccacggcatggtgctgcggtcgctgttcggcgagggcgac
ccggagttcgccgcggacccggccctgactccggggaacgtcttcctcgccgggacacgg
gcgttcgacccggaggaacgggcggcggtggcccgcgggctggtggtgacgtcggtcgag
gcgctgacggccgtcgaaaagctgtacgtgcacgtggatctggacgtgctggacccgggc
gagttcgcgggcttgaactacccggagccggacggctggacgatcgcgcggctggtgtcg
gaactggacgcgctggcccggttcgaggtggtcggcgcggggatcaccgagtgcgtgggg
acgccgcgtgaagtcgaggtcctggagccggtgctggcggcgatcggccgcctgctcggc
tga

DBGET integrated database retrieval system