KEGG   Amycolatopsis mediterranei S699: AMES_1896Help
Entry
AMES_1896         CDS       T02190                                 

Gene name
aceB
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMES_1896 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMES_1896 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    AMES_1896 (aceB)
Enzymes [BR:amm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AMES_1896 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2059971..2061548
Genome map
AA seq 525 aa AA seqDB search
MSSEVQVLGDPVERGDEILTPEALAFLAGLHDAFAGRRDELLQARGKRREEARTTGRLDF
LPETEEIREGDWQVAGAPPALRDRRVEITGPTDRKMTINALNSGAKVWLADLEDANTPHW
ANVVSGQVNLYDAVRETITLESGGKSYALKDDVEHATIVVRPRGWHLPESHLTFGGREGV
GALVDFGLHFFHNAAELLKRGKGPYYYLPKMESHLEARLWNDVFTHAEKTLGIEHGTVRA
TVLIETIPAAFEMEEILYELREHASGLNAGRWDYLFSVIKYFRDAGEKFVLPDRNSVTMT
APFMRAYTELLVRTCHKRGAFAIGGMAAFIPSKDPETNKGAFEKVHADKSREAGDGFDGS
WVAHPGMVELCKEEFDKVLGDKPNQLDRTRDEVSVTADQLLDVASTPGGATAAGLRAAVD
VGVRYIASWLGGNGAAAIHNLMEDAATAEISRSQIWQWVKNGTTLDSGDVVTAELVRGVL
ADVRGELAGELKPEQLEPAVELFEQVALAEEFPDFLTLPAYERIK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgaagtccaggtgctgggcgacccggtcgagcgcggcgacgagatcctcacg
ccggaggcgctcgccttcctcgccggcctccacgacgccttcgccggccgccgcgacgag
ctgctccaggcgcgcggcaagcgtcgcgaagaggcccggaccaccggccggctcgacttc
ctgcccgagaccgaggagatccgcgaaggcgactggcaggtcgccggcgcgccgcccgcg
ctgcgggaccgccgcgtcgagatcaccgggccgaccgaccgcaagatgaccatcaacgcg
ctcaactccggcgcgaaggtgtggctggccgacctcgaggacgccaacaccccgcactgg
gcgaacgtggtgtccggccaggtcaacctctacgacgccgtccgcgagacgatcaccctg
gagagcggcggcaagagctacgcgctgaaggacgacgtcgagcacgcgacgatcgtggtc
cgcccgcggggctggcacctgcccgagagccacctcaccttcggcggccgcgagggtgtc
ggcgcgctcgtcgacttcggcctgcacttcttccacaacgcggccgagctgctcaagcgc
ggcaagggcccgtactactacctgccgaagatggagagccacctcgaagcgcggctctgg
aacgacgtcttcacccacgccgagaagacactcggcatcgagcacggcaccgtccgcgcg
accgtgctgatcgagaccatcccggccgcgttcgagatggaagagatcctctacgagctg
cgcgagcacgcctcgggcctcaacgccggccgctgggactacctgttcagcgtgatcaag
tacttccgcgacgcgggcgagaagttcgtgctgccggaccgcaactcggtcaccatgacc
gcgccgttcatgcgcgcctacaccgagctgctggtgcgcacctgccacaagcgcggtgcc
ttcgcgatcggcggcatggccgcgttcatcccgagcaaggaccccgagaccaacaagggc
gccttcgagaaggtccacgcggacaagtcgcgcgaggccggcgacggcttcgacggttcc
tgggtcgcgcacccgggcatggtcgagctctgcaaggaggagttcgacaaggtcctcggc
gacaagcccaaccagctcgaccgcacccgcgacgaggtgagtgtcacggccgaccagctg
ctcgacgtcgcttcgacgccgggcggggcgacggcggccggcctgcgtgccgcggtcgac
gtcggcgtccgctacatcgcgtcctggctgggcggcaacggcgcggcggccatccacaac
ctgatggaggacgccgccaccgccgagatctcgcgctcgcagatctggcagtgggtcaag
aacgggaccactttggacagtggcgacgtcgtgacggcggagctggtgcgcggggtgctg
gccgacgtccgcggcgagctggccggcgagctcaagcccgagcagctggagcccgcggtg
gagctgttcgagcaggtcgcgctggccgaggagttcccggacttcctgacgctgcccgcc
tacgagcggatcaagtag

DBGET integrated database retrieval system