KEGG   Amycolatopsis mediterranei S699: AMES_1910Help
Entry
AMES_1910         CDS       T02190                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AMES_1910
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    AMES_1910
Enzymes [BR:amm01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     AMES_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2076787..2077668)
Genome map
AA seq 293 aa AA seqDB search
MAITLGPNQYGKAEVRLVTVRRDGPVHHLKDLTVSTSLRGELAATHLTGDNAGVLATDTQ
KNTVYAFAKEAPVGEIEDFGLRLARHFVGTQENITGARIKIDEHGWDRIAVGAEPHDHAF
SRSGDERRTTAVTVQDGRAWIVSGIDGLTLLKSTGSEFHGFPRDEYTTLAETGDRILATA
VTAKWRYQGEDIDWASSHREIRRVMLETFATKHSLSLQQTLYAMGSAVLEARPEVAEVRL
SLPNKHHFLVDLSPFGLKNDNEVFYAADRPYGLIEGTILRDDAEDAGPAWDLH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtggccatcaccctgggccccaaccagtacggcaaggcggaggtccgcctggtgacggtg
cgccgcgacgggccggtgcaccacctgaaggacctgacggtgtcgacgtcgctgcgcggc
gagctggccgcgacgcacctgaccggcgacaacgccggggtgctggcgaccgacacgcag
aagaacacggtgtacgccttcgcgaaggaggcgccggtcggtgagatcgaggacttcggc
ctgcgcctggcccggcacttcgtcggcacgcaggagaacatcacgggcgcgcgcatcaag
atcgacgagcacggctgggaccggatcgccgtcggcgccgagccgcacgaccacgcgttc
agccgatccggcgacgagcgccgcacgacggcggtgacggtgcaggacggccgcgcgtgg
atcgtgtccggcatcgacggcctgacgctgctgaagtccacgggttcggagttccacggc
ttcccccgcgacgagtacacgaccctggcggagacgggcgaccggatcctggcgacggcc
gtcacggcgaagtggcgttatcagggcgaggacatcgactgggcttcgagtcaccgcgag
atccggcgggtgatgctcgagacgttcgcgacgaagcacagcctttcgctgcagcagacg
ctgtacgcgatgggttcggcggtgctggaggcgcggccggaggtggccgaggtgcggttg
tcgctgccgaacaagcaccacttcctggtggacttgagcccgttcgggctgaagaacgac
aacgaggtgttctatgcggcggaccggccgtacgggctgatcgagggcaccatcctgcgc
gacgacgccgaggacgcggggccggcctgggacctccactga

DBGET integrated database retrieval system