KEGG   Amycolatopsis mediterranei S699: AMES_2020Help
Entry
AMES_2020         CDS       T02190                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose-5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMES_2020 (dxr)
Enzymes [BR:amm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AMES_2020 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2188463..2189641
Genome map
AA seq 392 aa AA seqDB search
MLGSTGSIGVQALDVAARNPHLFRVAGIAAGGADPAALAAQAIAHGVEAVAVTRATAAED
VQLALYAEAQQRGYARGEFKLPRLFAGSDAVTELIDAVKVDTVLNALPGSRGLEPTLKAL
ATGATLALANKESLIAGGPLVLAAAKPGQLVPVDSEHSAIAQALRAGHRSEVARLVLTAS
GGPFRGRKRAELAGVTVEQAMAHPTWSMGPLITINSATLVNKGLELIEAALLFDVEPAKI
DVTVHPQSIVHSMVTFADGSTIAQASPPDMRLPIALALHWPDRVPDAAPACTWDQAATWT
FEPLDDEAFPAVELARHCGTAGGCLPAVYNAANEELVSAFLAQNTSFTSIVDTVSEVVGA
ADEWRREPRDVEDVLAAERWARARAGSIIEGK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggctcgaccgggtccatcggcgtgcaggccctcgacgtcgccgcgcgcaacccg
cacctgttccgggtggccgggatcgccgcgggcggcgccgatccggccgcgctcgccgcg
caggcgatcgcccacggcgtcgaggccgtcgccgtgacgagggccacggccgccgaagac
gtccagctcgcgctgtacgccgaagcgcagcagcgcgggtacgcccggggcgagttcaag
ctcccgcggctcttcgcgggctccgacgccgtcaccgagctgatcgacgcggtcaaggtc
gacaccgtgctcaacgcgctcccgggctcccgcggcctcgagccgaccctcaaagcgctc
gccaccggcgccaccctcgcgctggccaacaaggagtccctgatcgccggcgggccgctg
gtgctcgccgcggccaagcccgggcagctcgtgcccgtcgactccgagcactccgccatc
gcccaggccctgcgcgccgggcaccgcagcgaggtcgcccggctcgtcctcaccgcctcc
ggcggcccgttccgcggccgcaagcgcgcggagctggccggcgtcaccgtcgagcaggcg
atggcgcacccgacctggtcgatgggcccgctcatcacgatcaactccgccaccctggtc
aacaagggcctggagctgatcgaggcggcgctgctgttcgacgtcgagcccgcgaagatc
gacgtcaccgtgcacccgcagtcgatcgtgcactcgatggtgaccttcgccgacggctcg
acgatcgcccaggccagcccgcccgacatgcggctgcccatcgcgcttgcgctgcactgg
cccgaccgggtccccgacgccgcccccgcgtgcacctgggaccaggccgcgacctggacg
ttcgagccgctggacgacgaggccttcccggccgtcgagctggcccggcactgcggcacc
gcgggcggctgcctgcccgccgtctacaacgccgcgaacgaggagctcgtgtccgctttc
ctggcgcagaacaccagcttcacgtcgatagtggacactgtttccgaggtggtgggagcc
gccgacgaatggcgtcgcgaaccacgcgacgtcgaggacgttctcgcggccgagcggtgg
gctcgtgcgcgggccggttcgatcatcgaggggaagtag

DBGET integrated database retrieval system