KEGG   Amycolatopsis mediterranei S699: AMES_2268Help
Entry
AMES_2268         CDS       T02190                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMES_2268 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMES_2268 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMES_2268 (trpB)
Enzymes [BR:amm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMES_2268 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2449224..2450435
Genome map
AA seq 403 aa AA seqDB search
MTQEHDKHDPDERGYYGPYGGRFMPEALIGVVDEVATEYDKARHDPEFLNEFNRLLRDYA
GRPSLLTEAKRFGEHAGGARVFLKREDLNHTGSHKINNVLGQALLTKRMGKKRVIAETGA
GQHGVATATACALLDLDCVVYMGEVDTERQALNVARMRLLGAEVIPVKTGSRTLKDAINE
ALRDWVTNADTTHYLFGTAAGPAPFPTMVRNFHHVIGTEAREQILEQAGRLPDVVAACVG
GGSNAIGIFSGFYDDPSVRLVGLEPGGEGIEGNRHGATLTKGTPGNLHGAMTYLLQDDDG
QTVESHSISAGLDYPGVGPEHAWLKDTGRAEYRPITDAQAMDAFKLLSRTEGIIPAIESA
HALAGALDLGRELGPEGLIVVNLSGRGDKDMDTAAKWFGLVNG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaggagcacgacaagcacgacccggacgagcgcggctactacggcccgtacggg
ggccggttcatgccggaggcgctgatcggcgtcgtcgacgaggtcgccaccgagtacgac
aaggcccggcacgacccggagttcttgaacgagttcaaccgcttgcttcgcgattacgcg
ggccgcccgtcgctgctcaccgaggccaagcgcttcggcgagcacgccggcggcgcgcgg
gtgttcctcaagcgcgaggacctgaaccacaccggctctcacaagatcaacaacgtgctg
ggtcaggcgctgctcaccaagcggatgggcaagaagcgcgtcatcgccgagaccggcgcg
ggccagcacggcgtcgcgacggccaccgcgtgcgcgctgctcgaccttgattgcgtcgtc
tacatgggcgaggtcgacaccgagcgccaggcgctgaacgtggcccgcatgcggctgctc
ggcgccgaggtgatcccggtcaagaccgggtcgcggacgctgaaggacgcgatcaacgag
gcgctgcgcgactgggtcaccaacgccgacaccacgcactacctcttcggcacggccgcc
gggccggcgccgttcccgacgatggtgcgcaacttccaccacgtcatcggcaccgaggcc
cgcgagcagatcctcgagcaggccgggcgcctgcccgacgtcgtcgcggcctgcgtcggc
ggcgggtcgaacgcgatcggcatcttctccggcttctacgacgacccgtccgtgcggctg
gtcggcctggagccgggcggcgagggcatcgagggcaaccgccacggcgccaccctgacc
aagggcaccccgggcaacctgcacggcgcgatgacgtacctgctgcaggacgacgacggc
cagacggtcgagtcgcactcgatctcggccgggctcgactacccgggcgtcggcccggag
cacgcgtggctcaaggacaccggccgcgccgagtaccgcccgatcaccgacgcccaggcg
atggacgcgttcaagctgctgtcccgcaccgaaggcatcatcccggcgatcgagtcggcg
cacgcgctggccggcgcgctggacctgggccgcgaactgggtcctgaaggattgatcgtg
gtgaatttgtctggccgcggcgacaaggacatggacacggcggccaagtggttcggactg
gtgaacggatga

DBGET integrated database retrieval system