KEGG   Amycolatopsis mediterranei S699: AMES_2268Help
Entry
AMES_2268         CDS       T02190                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00260  Glycine, serine and threonine metabolism
amm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01130  Biosynthesis of antibiotics
amm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMES_2268 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMES_2268 (trpB)
Enzymes [BR:amm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMES_2268 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFO75804
UniProt: G0G4X5
Position
2449224..2450435
Genome map
AA seq 403 aa AA seqDB search
MTQEHDKHDPDERGYYGPYGGRFMPEALIGVVDEVATEYDKARHDPEFLNEFNRLLRDYA
GRPSLLTEAKRFGEHAGGARVFLKREDLNHTGSHKINNVLGQALLTKRMGKKRVIAETGA
GQHGVATATACALLDLDCVVYMGEVDTERQALNVARMRLLGAEVIPVKTGSRTLKDAINE
ALRDWVTNADTTHYLFGTAAGPAPFPTMVRNFHHVIGTEAREQILEQAGRLPDVVAACVG
GGSNAIGIFSGFYDDPSVRLVGLEPGGEGIEGNRHGATLTKGTPGNLHGAMTYLLQDDDG
QTVESHSISAGLDYPGVGPEHAWLKDTGRAEYRPITDAQAMDAFKLLSRTEGIIPAIESA
HALAGALDLGRELGPEGLIVVNLSGRGDKDMDTAAKWFGLVNG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaggagcacgacaagcacgacccggacgagcgcggctactacggcccgtacggg
ggccggttcatgccggaggcgctgatcggcgtcgtcgacgaggtcgccaccgagtacgac
aaggcccggcacgacccggagttcttgaacgagttcaaccgcttgcttcgcgattacgcg
ggccgcccgtcgctgctcaccgaggccaagcgcttcggcgagcacgccggcggcgcgcgg
gtgttcctcaagcgcgaggacctgaaccacaccggctctcacaagatcaacaacgtgctg
ggtcaggcgctgctcaccaagcggatgggcaagaagcgcgtcatcgccgagaccggcgcg
ggccagcacggcgtcgcgacggccaccgcgtgcgcgctgctcgaccttgattgcgtcgtc
tacatgggcgaggtcgacaccgagcgccaggcgctgaacgtggcccgcatgcggctgctc
ggcgccgaggtgatcccggtcaagaccgggtcgcggacgctgaaggacgcgatcaacgag
gcgctgcgcgactgggtcaccaacgccgacaccacgcactacctcttcggcacggccgcc
gggccggcgccgttcccgacgatggtgcgcaacttccaccacgtcatcggcaccgaggcc
cgcgagcagatcctcgagcaggccgggcgcctgcccgacgtcgtcgcggcctgcgtcggc
ggcgggtcgaacgcgatcggcatcttctccggcttctacgacgacccgtccgtgcggctg
gtcggcctggagccgggcggcgagggcatcgagggcaaccgccacggcgccaccctgacc
aagggcaccccgggcaacctgcacggcgcgatgacgtacctgctgcaggacgacgacggc
cagacggtcgagtcgcactcgatctcggccgggctcgactacccgggcgtcggcccggag
cacgcgtggctcaaggacaccggccgcgccgagtaccgcccgatcaccgacgcccaggcg
atggacgcgttcaagctgctgtcccgcaccgaaggcatcatcccggcgatcgagtcggcg
cacgcgctggccggcgcgctggacctgggccgcgaactgggtcctgaaggattgatcgtg
gtgaatttgtctggccgcggcgacaaggacatggacacggcggccaagtggttcggactg
gtgaacggatga

DBGET integrated database retrieval system