KEGG   Amycolatopsis mediterranei S699: AMES_2269Help
Entry
AMES_2269         CDS       T02190                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:amm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:amm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2450432..2451223
Genome map
AA seq 263 aa AA seqDB search
MSGLDDLFAATRAEGRAALIGYLPAGFPTVEGSKDLIAACVDGGADLIEVGVPYSDPVMD
GPTIQAASVTALDNGFRLKHVFEVVESISARGGRAVVMTYWNPVNRYGVDRFARDLASAG
GLGLITPDLIPDEAGAWIAASETHGLDRTFLVAPSSSEERLALTAAASSGFIYATAVMGV
TGARDQVGAGAEELVRRTRVHTSLPIGVGLGVRSGDQAAEVASFADAVIVGSALVTAAAE
GSSGVRALSAELAEGVRRAVATA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggctcgacgacctcttcgccgcgacgcgcgccgaggggcgcgccgcgctgatc
ggctacctcccggcgggcttccccacggtcgagggctcgaaggacctgatcgcggcctgc
gtcgacggcggcgcggacctgatcgaggtcggcgtcccgtattcggacccggtgatggac
ggcccgaccatccaggccgcctcggtgaccgcgctggacaacgggttccgcctcaagcac
gtgttcgaggtcgtcgagtcgatctcggcccgcggcggccgtgcggtcgtgatgacgtac
tggaacccggtgaaccgctacggcgtggaccgcttcgcgcgtgacctcgcctcggcgggc
gggctcggcctgatcacgccggacctgatcccggacgaggccggcgcgtggatcgcggca
tcggagacccacggcctggaccgcaccttcctggtggcgccttcgtcgtcggaagagcgg
ctcgcgttgacggcggcggcgtcgtcgggcttcatctacgcgaccgcggtgatgggcgtg
acgggcgcgcgcgaccaggtcggagccggagcggaggagctggtgcgccgcacgcgagtg
cacacttcgcttccgatcggcgtgggcctgggtgtccggtcgggcgaccaggcggccgag
gtggcgtccttcgcggacgcggtgatcgtgggctcggccctggtcacggcggcggccgaa
ggctcgtcgggcgttcgtgccctgtcggccgagctggccgagggcgtgcgccgggcggtc
gccaccgcttga

DBGET integrated database retrieval system