KEGG   Amycolatopsis mediterranei S699: AMES_2429Help
Entry
AMES_2429         CDS       T02190                                 

Gene name
yvaK
Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
amm  Amycolatopsis mediterranei S699
Brite
Enzymes [BR:amm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     AMES_2429 (yvaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2627398..2628165)
Genome map
AA seq 255 aa AA seqDB search
MGVLAGAEPFGHTGSAETGFLLCHGFTGTPASMRAWGDHLAGAGFTVRCPLLPGHGTRWP
DLNRTTWEDWYGAVREALLALLATCKTVFVGGLSMGGTLTLRLAEEFGDRIAGIVLVNPS
VTRLKWDTRLLPVLGRIVPSVPAIANDIKKPGETELAYPRTPVRAAASLAKLWAVVRADL
AKVTQPVLLLHSSVDHVVEPVNSQLVLDGVSSTDVTEVVLENSYHVATQDNDAEVIFTRS
VEFAKAHAAQPEETA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgctcgccggcgcggaaccgttcggccacaccggttcggccgaaaccgggttc
ctgctctgccacgggttcaccggtaccccggcgagcatgcgggcctggggtgaccacctg
gccggggccgggttcacggtgcgctgcccgctgctgccgggccacggcacccgctggccg
gacctcaaccgcacgacgtgggaggactggtacggcgccgtgcgcgaagccctgctcgcg
ctgctggcgacgtgcaagaccgtgttcgtcggcggcctctcgatgggcggcacgctcacg
ctgcgcctggccgaggagttcggcgaccggatcgccgggatcgtcctggtcaacccgtcg
gtgacgcggctgaagtgggacacgcggctgctgccggtgctgggccggatcgtgccgtcg
gtgccggcgatcgcgaacgacatcaagaagccgggcgagacggagctggcctacccgcgg
acgccggtgcgcgcggcggcgagcctcgcgaagctgtgggcggtcgtgcgcgccgacctg
gcgaaggtgacgcagccggtgctgctgctgcactcgtcggtcgaccacgtcgtcgagccg
gtgaactcgcagctggtgctcgacggcgtctcgagcaccgacgtcaccgaggtcgtgctg
gagaacagctaccacgtggcgacgcaggacaacgacgccgaggtgattttcacgcgtagc
gtcgagttcgcgaaggcgcacgctgcccagccggaggagaccgcatga

DBGET integrated database retrieval system