KEGG   Amycolatopsis mediterranei S699: AMES_2433Help
Entry
AMES_2433         CDS       T02190                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMES_2433 (pfk)
   01230 Biosynthesis of amino acids
    AMES_2433 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMES_2433 (pfk)
   00030 Pentose phosphate pathway
    AMES_2433 (pfk)
   00051 Fructose and mannose metabolism
    AMES_2433 (pfk)
   00052 Galactose metabolism
    AMES_2433 (pfk)
  Energy metabolism
   00680 Methane metabolism
    AMES_2433 (pfk)
Enzymes [BR:amm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AMES_2433 (pfk)
Protein phosphatases and associated proteins [BR:amm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AMES_2433 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2631307..2632332
Genome map
AA seq 341 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVVRKGIEVHGWDFVGFRNGWNGPLTGDSRPLGLNDVEDI
LTRGGTILRSSRTNPYKVEGGVDKIKQVLADQGVDALIAIGGEDTLGVAKRLTDDGIGVV
GVPKTIDNDLGATDYTFGFDTAVSIATEAIDRLHTTAESHHRALVVEVMGRHAGWIALHS
GLAGGASVILVPERHFNVDQVVSWVERRFEKEFAPIIVVAEGALPEGGEEKLLTGEKDAF
GHVRLGGIGTWLADEIAHRTGKESRAVVLGHVQRGGTPTAYDRVLATRFGLNAVDAVADG
DFGVMVALKGTDIVRVKLSEATAELKTVPVERYQEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcggtgtgctgaccggcggcggcgactgcccggggctcaacgcggtgatccgc
gcggtggtgcgcaagggcatcgaggtgcacggctgggacttcgtgggcttccgcaacggc
tggaacggcccgctgaccggcgacagccgcccgctgggcctgaacgacgtcgaggacatc
ctcacccgcggcggcaccatcctgcggtcctcgcgcaccaacccctacaaggtcgagggc
ggcgtcgacaagatcaagcaggtcctcgccgatcaaggcgtcgacgcgctgatcgcgatc
ggcggcgaggacaccctcggcgtcgcgaagcggctgaccgacgacggcatcggcgtcgtg
ggcgtgcccaagacgatcgacaacgacctgggcgcgaccgactacaccttcggcttcgac
accgcggtctccatcgcgaccgaggcgatcgaccggctgcacaccacggccgagtcgcac
caccgcgcgctcgtcgtcgaggtcatgggccggcacgccggctggatcgcgctgcactcc
ggcctcgccggcggcgccagcgtcatcctggtgccggagcggcacttcaacgtcgaccag
gtcgtctcctgggtcgagcgccgcttcgagaaggagttcgcgccgatcatcgtcgtcgcc
gagggcgcactgcccgagggtggcgaggagaagctgctgaccggcgagaaggacgccttc
gggcacgtccgcctcggcggcatcggcacctggctggccgacgagatcgcccaccgcacc
ggcaaggagtcccgcgcggtcgtgctgggccacgtccagcgcggcggcaccccgacggcc
tacgaccgcgtcctggccacccgcttcggcctcaacgcggtcgacgcggtcgcggacggc
gacttcggtgtgatggtcgccctcaagggcacggacatcgtccgcgtgaagctgtccgag
gcgacggccgagctgaagacggtcccggtcgagcgctaccaggaagccgaagtcttcttc
ggctga

DBGET integrated database retrieval system