KEGG   Amycolatopsis mediterranei S699: AMES_2433Help
Entry
AMES_2433         CDS       T02190                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00010  Glycolysis / Gluconeogenesis
amm00030  Pentose phosphate pathway
amm00051  Fructose and mannose metabolism
amm00052  Galactose metabolism
amm00680  Methane metabolism
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01120  Microbial metabolism in diverse environments
amm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMES_2433 (pfk)
   00030 Pentose phosphate pathway
    AMES_2433 (pfk)
   00051 Fructose and mannose metabolism
    AMES_2433 (pfk)
   00052 Galactose metabolism
    AMES_2433 (pfk)
  Energy metabolism
   00680 Methane metabolism
    AMES_2433 (pfk)
Enzymes [BR:amm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AMES_2433 (pfk)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     AMES_2433 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFO75969
UniProt: Q9AGC0
Position
2631307..2632332
Genome map
AA seq 341 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVVRKGIEVHGWDFVGFRNGWNGPLTGDSRPLGLNDVEDI
LTRGGTILRSSRTNPYKVEGGVDKIKQVLADQGVDALIAIGGEDTLGVAKRLTDDGIGVV
GVPKTIDNDLGATDYTFGFDTAVSIATEAIDRLHTTAESHHRALVVEVMGRHAGWIALHS
GLAGGASVILVPERHFNVDQVVSWVERRFEKEFAPIIVVAEGALPEGGEEKLLTGEKDAF
GHVRLGGIGTWLADEIAHRTGKESRAVVLGHVQRGGTPTAYDRVLATRFGLNAVDAVADG
DFGVMVALKGTDIVRVKLSEATAELKTVPVERYQEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcggtgtgctgaccggcggcggcgactgcccggggctcaacgcggtgatccgc
gcggtggtgcgcaagggcatcgaggtgcacggctgggacttcgtgggcttccgcaacggc
tggaacggcccgctgaccggcgacagccgcccgctgggcctgaacgacgtcgaggacatc
ctcacccgcggcggcaccatcctgcggtcctcgcgcaccaacccctacaaggtcgagggc
ggcgtcgacaagatcaagcaggtcctcgccgatcaaggcgtcgacgcgctgatcgcgatc
ggcggcgaggacaccctcggcgtcgcgaagcggctgaccgacgacggcatcggcgtcgtg
ggcgtgcccaagacgatcgacaacgacctgggcgcgaccgactacaccttcggcttcgac
accgcggtctccatcgcgaccgaggcgatcgaccggctgcacaccacggccgagtcgcac
caccgcgcgctcgtcgtcgaggtcatgggccggcacgccggctggatcgcgctgcactcc
ggcctcgccggcggcgccagcgtcatcctggtgccggagcggcacttcaacgtcgaccag
gtcgtctcctgggtcgagcgccgcttcgagaaggagttcgcgccgatcatcgtcgtcgcc
gagggcgcactgcccgagggtggcgaggagaagctgctgaccggcgagaaggacgccttc
gggcacgtccgcctcggcggcatcggcacctggctggccgacgagatcgcccaccgcacc
ggcaaggagtcccgcgcggtcgtgctgggccacgtccagcgcggcggcaccccgacggcc
tacgaccgcgtcctggccacccgcttcggcctcaacgcggtcgacgcggtcgcggacggc
gacttcggtgtgatggtcgccctcaagggcacggacatcgtccgcgtgaagctgtccgag
gcgacggccgagctgaagacggtcccggtcgagcgctaccaggaagccgaagtcttcttc
ggctga

DBGET integrated database retrieval system