KEGG   Amycolatopsis mediterranei S699: AMES_2616Help
Entry
AMES_2616         CDS       T02190                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00860  Porphyrin and chlorophyll metabolism
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
Module
amm_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMES_2616 (hemY)
Enzymes [BR:amm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AMES_2616 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     AMES_2616 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 Pyr_redox_2 NAD_binding_9 HI0933_like Trp_halogenase Pyr_redox FMO-like NAD_binding_7 MCRA
Motif
Other DBs
NCBI-ProteinID: AFO76152
UniProt: G0G9B7
Position
2841208..2842608
Genome map
AA seq 466 aa AA seqDB search
MKRVAVVGGGVSGLTAAYRLRQLLGPEAEITVYEKTTAPGGKLRTAELAGVPYDVGAEAF
LVRRPEMLALARELGLDVVHPTKARAKIHAGGAVTGLPPGTVMGVPASAESVAGVLSETG
RQAVEAEPLLPELRLPGGDVPLGPLLRERFGDELVDRLVDPLLGGVYAGGADGLGLRATM
PGLASALAAGAGSLTAAAAAQLPANPSTAPVFGTVPGGLGTVIDRLTTASGAQLRTGLPV
CEIERHGDGWRLCIGAAPTAHAPADNLAEADAVVLAVPAPSARRLLTDLVPAASAAFGEV
ELASMAVVALALPPGTALPEASGILIGQGERDASGVPYASKAFTFSSRKWAHYGTGPVLV
RGSVGRFGEPGALQFDDVELVRVVRDDLARLTGVTAAPVETLVTRWGGGLPQYGTGHLER
VERIEKAVAEVPGLAIAGATLHGVGLPACVATAEAAAQRIAAHLTA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgcgtcgcggtcgtcgggggcggcgtttccgggctgaccgcggcgtaccggctc
cggcagctgctcggccccgaagccgagatcacggtgtacgagaagacgacggcgccgggc
gggaagctgcgcaccgccgaactcgccggggtgccctacgacgtcggcgccgaggcgttc
ctcgtccgccgtcccgaaatgctcgcgctggcccgcgagctcgggctcgacgtcgtccac
ccgacgaaggcgcgggcgaagatccacgcgggcggcgccgtcaccgggctgccgcccggc
acggtcatgggcgtgccggcgtcggcggagtcggtggccggggtgctttccgaaaccggc
cggcaggcggtcgaggccgagccgttgctgccggagctgcggctgccgggcggggacgtg
ccgctggggccgctgctgcgcgagcggttcggcgacgaactggtggaccggctggtcgac
ccgctgctcggcggcgtctacgcgggcggggcggacggcctcggcctgcgcgcgaccatg
cccggcctcgcctccgcgctggcggcgggcgcgggctcgctgaccgcggcggccgccgcc
cagctgccggcgaacccgtcgacggcgccggtgttcggcaccgtccctggcggcctcggc
acggtgatcgaccggctcaccacggcgtcgggcgcgcagctgcggaccggcctgccggtg
tgcgagatcgaacggcacggcgacggctggcggctgtgcatcggcgcggcaccgaccgcg
cacgcgccggcggacaacctcgccgaagcggacgcggtcgtgctcgcggtgcccgcgccg
tcggcccgccgcctgctcaccgacctcgtcccggcggcttcggcggccttcggcgaggtc
gaactggcgtcgatggcggtggtcgcgctggcactgccgcccggcaccgcgctgcccgag
gcgtcggggatcctgatcggccagggcgagcgggacgcttcgggcgtgccgtacgcgtcg
aaggcgttcacgttctcgtcgcggaagtgggcccactacggcaccggcccggtcctggtc
cgcggctcggtcggccggttcggcgagccgggcgcgctgcagttcgacgacgtcgagctg
gtccgcgtggtccgcgacgacctcgcccggctgacgggggtgacggcggcgccggtcgag
acgctggtgacgcggtggggcggcgggctgccgcagtacggcaccgggcacctcgagcgg
gtcgagcggatcgagaaggccgtcgcggaggtgccgggcctggcgatcgccggggcgacc
ctgcacggggtcgggctgccggcctgtgtcgcgacggcggaagccgcggcccagcggatc
gcggcgcacctgacggcgtga

DBGET integrated database retrieval system