KEGG   Amycolatopsis mediterranei S699: AMES_2794Help
Entry
AMES_2794         CDS       T02190                                 

Gene name
desC
Definition
stearoyl-CoA desaturase (delta-9 desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:amm01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:amm01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3024020..3024937)
Genome map
AA seq 305 aa AA seqDB search
MTSRTAPKPLISHRRGTGEMIVLKTFLLVPFAALLIAVPLVWGWGMSWIDLILAAAFYTF
ATLGVTVGFHRYFTHGAFKASRPLRVLLAIAGSMAVQGSVIFWVASHRRHHAFADREGDP
HSPWLFGTSPSALLRGFWHAHMGWMFGREVTNADRFAPDLVADPDVRWVNRYFWLWITLS
LALPAVLGGLISWSWWGVVTAFFWAGLVRIAFLHHVTWSVNSVCHLIGERPFASRDKAAN
FWPLALLSMGESWHNSHHADPTCARHGVLRGQVDVSARVIWAFERFGWATDVRWPRADRL
AAKRA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgcgcaccgcgcccaagccgctgatctcccaccgccgcggcaccggcgagatg
atcgtgctcaagaccttcctgctggtgccgttcgcggccctgctcatcgcggtcccgctg
gtgtggggctggggcatgagctggatcgacctcatcctcgcggcggcgttctacacgttc
gcaacgctcggggtgacggtcggcttccaccggtacttcacccacggcgcgttcaaggcg
tcgcgtcccctgcgggtgctgctggccatcgcgggcagcatggcggtgcagggctcggtg
atcttctgggtggccagtcaccgccgccaccacgcgttcgccgaccgcgagggcgacccg
cactcgccgtggctgttcggcacttccccgtcggccctgctgcgcggcttctggcacgcg
cacatgggctggatgttcggccgcgaggtgaccaacgcggaccgcttcgcccccgacctg
gtggcggacccggacgtccgctgggtgaaccggtacttctggctgtggatcacgttgagc
ctggccctgccggcggtcctgggcggcctgatctcgtggtcctggtggggcgtggtgacg
gcgttcttctgggcgggcctggtgcgcatcgcgttcctgcaccacgtgacgtggtcggtg
aactcggtctgccacttgatcggcgagaggccgttcgccagccgcgacaaggcggcgaac
ttctggccgctggcgttgctgtcgatgggcgagtcctggcacaactcccaccacgcggat
ccgacgtgcgcccggcacggggtgctgcgggggcaggtggacgtttcggcgcgggtgatc
tgggcgttcgagcggttcgggtgggcgaccgacgtgcggtggccgcgagcggaccggctg
gccgcgaagcgggcctga

DBGET integrated database retrieval system