KEGG   Amycolatopsis mediterranei S699: AMES_3411Help
Entry
AMES_3411         CDS       T02190                                 

Gene name
adh
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AMES_3411 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMES_3411 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    AMES_3411 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AMES_3411 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AMES_3411 (adh)
   00626 Naphthalene degradation
    AMES_3411 (adh)
Enzymes [BR:amm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AMES_3411 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3743139..3744161
Genome map
AA seq 340 aa AA seqDB search
MVALPTTMHAWRVLRPGPVAGGPVDLVRAPVPRAGVGELLVRVLVCGVCRTDLHVAEGDL
PVHRQGVTPGHEVVGEVVELGADVTGFATGDRVGIAWLRATCGRCRYCLGGRENLCPESR
YTGWDADGGYAEFAVVPAAYALPLPGGYSDDQLAPLLCAGLIGYRALARAELPEGGRLGL
YGFGGSAHLTAQVAIARGAAVHVLTRSAAARELALELGAASAGEAAEPPPEPLDSAILFA
PVGDLVLPALAALDRGGTLAIAGIHLSDVPPLEYQRHLFQERQVRSVTANTRADAREFLD
FAGRHHLEVSTVPYALDAADRALTDLAADRVNGAAVLRAT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcgctgccgacgacgatgcacgcttggcgcgtcctgcggccgggcccggtggcg
ggcgggccggtggacctggtgcgggcgccggtgccgcgggcgggcgtgggggagctgctg
gtgcgggtgctggtgtgcggggtgtgccggacggacctgcacgtggcggagggtgacctg
ccggtgcaccggcagggggtgacgccggggcacgaggtcgtcggcgaagtggtcgagctc
ggcgcggacgtcacgggcttcgcgaccggtgaccgggtggggatcgcgtggctgcgcgcc
acctgcgggcggtgccggtactgcctgggcgggcgcgagaacctgtgtccggagtcgcgg
tacaccggctgggacgccgacggcggctacgcggagttcgcggtcgtcccggcggcgtac
gcgttgccgctgcccggcggctattccgatgaccagctggcgccgctgctctgcgccggg
ctgatcgggtaccgcgcgctcgcacgggcggaactgcccgaaggcggccggctgggcctc
tacgggttcggcggcagcgcgcacctgaccgcccaggtggcgatcgcgcggggtgccgcg
gtgcacgtgctgacgcgcagcgcggccgcccgtgagctggcgctggagctgggggccgcg
tcggccggggaggcggccgagccacctcccgagccgctggactcggcgatcctgttcgcg
cccgtgggtgacctggtgctcccggcgctggccgcgctcgatcgcggcgggacgctcgcc
atcgcgggcatccacctctccgacgtgccgccgctggagtaccagcggcacttgttccag
gaacgtcaggtgcgcagcgtcaccgcgaacacccgggcggacgcgcgggagttcctggac
ttcgccgggcgccatcacctggaggtgagcacggtgccctacgcgctggacgcggcggac
cgggccctgaccgacctggccgcggaccgggtgaacggcgcggcggtgctgcgcgccacc
tga

DBGET integrated database retrieval system