KEGG   Amycolatopsis mediterranei S699: AMES_3411Help
Entry
AMES_3411         CDS       T02190                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00010  Glycolysis / Gluconeogenesis
amm00071  Fatty acid degradation
amm00350  Tyrosine metabolism
amm00625  Chloroalkane and chloroalkene degradation
amm00626  Naphthalene degradation
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01120  Microbial metabolism in diverse environments
amm01130  Biosynthesis of antibiotics
amm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMES_3411 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    AMES_3411 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AMES_3411 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AMES_3411 (adh)
   00626 Naphthalene degradation
    AMES_3411 (adh)
Enzymes [BR:amm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AMES_3411 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AFO76947
UniProt: G0FPS8
Position
3743139..3744161
Genome map
AA seq 340 aa AA seqDB search
MVALPTTMHAWRVLRPGPVAGGPVDLVRAPVPRAGVGELLVRVLVCGVCRTDLHVAEGDL
PVHRQGVTPGHEVVGEVVELGADVTGFATGDRVGIAWLRATCGRCRYCLGGRENLCPESR
YTGWDADGGYAEFAVVPAAYALPLPGGYSDDQLAPLLCAGLIGYRALARAELPEGGRLGL
YGFGGSAHLTAQVAIARGAAVHVLTRSAAARELALELGAASAGEAAEPPPEPLDSAILFA
PVGDLVLPALAALDRGGTLAIAGIHLSDVPPLEYQRHLFQERQVRSVTANTRADAREFLD
FAGRHHLEVSTVPYALDAADRALTDLAADRVNGAAVLRAT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcgctgccgacgacgatgcacgcttggcgcgtcctgcggccgggcccggtggcg
ggcgggccggtggacctggtgcgggcgccggtgccgcgggcgggcgtgggggagctgctg
gtgcgggtgctggtgtgcggggtgtgccggacggacctgcacgtggcggagggtgacctg
ccggtgcaccggcagggggtgacgccggggcacgaggtcgtcggcgaagtggtcgagctc
ggcgcggacgtcacgggcttcgcgaccggtgaccgggtggggatcgcgtggctgcgcgcc
acctgcgggcggtgccggtactgcctgggcgggcgcgagaacctgtgtccggagtcgcgg
tacaccggctgggacgccgacggcggctacgcggagttcgcggtcgtcccggcggcgtac
gcgttgccgctgcccggcggctattccgatgaccagctggcgccgctgctctgcgccggg
ctgatcgggtaccgcgcgctcgcacgggcggaactgcccgaaggcggccggctgggcctc
tacgggttcggcggcagcgcgcacctgaccgcccaggtggcgatcgcgcggggtgccgcg
gtgcacgtgctgacgcgcagcgcggccgcccgtgagctggcgctggagctgggggccgcg
tcggccggggaggcggccgagccacctcccgagccgctggactcggcgatcctgttcgcg
cccgtgggtgacctggtgctcccggcgctggccgcgctcgatcgcggcgggacgctcgcc
atcgcgggcatccacctctccgacgtgccgccgctggagtaccagcggcacttgttccag
gaacgtcaggtgcgcagcgtcaccgcgaacacccgggcggacgcgcgggagttcctggac
ttcgccgggcgccatcacctggaggtgagcacggtgccctacgcgctggacgcggcggac
cgggccctgaccgacctggccgcggaccgggtgaacggcgcggcggtgctgcgcgccacc
tga

DBGET integrated database retrieval system