KEGG   Amycolatopsis mediterranei S699: AMES_3604Help
Entry
AMES_3604         CDS       T02190                                 

Gene name
galA
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:amm00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:amm00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:amm00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3962999..3964954)
Genome map
AA seq 651 aa AA seqDB search
MAVAIAACTSVVTVAEAVPAAAAEPGYFAAQRVGERPPMGWNSWNRFGCDINEDLVRGAA
DALVSSGMKDAGYQYINIDDCWAEQNRTAEGKLEPSHERFPHGIKTLADYVHGLGLKLGI
YTSAGTLTCQKTMPGALDHEEADAQSFADWGVDYLKYDNCNNQGRPAIERYTKMGDAIKK
TGRPMIYALCEWGENKPWTWGRDAGAQLWRTTGDISDNWGSMTGILDQQVGLEKFAGPGG
WNDPDMLEVGNGGMTDTEYRSHFALWALLNAPLLAGNDLPAMSPATKAILENNDVIALDQ
DWAGTQGRKLRDDGDTEVWAKPMSDGSAAVVLFNRGSASTTISTTAAELGLEGHTFRVRD
LWTGTETETAGTLRDAVASHDSSVFRVWPSTHPSAAPMTTLALPAPDYVPADRPLTTTLQ
VINDGSTPITQLRATVATPVGWQLDGPGTFTVPAVPPGKSWQQQITFKPVAPGGERVRLA
AKADYSTAWGKRALGSEGTSPLVSRPSSGTTALSKAPWMSSDNGWGPVERGTSNGESQPG
DGHRITIAGVGYDDGIGAHAPSSVRVYVGASCTSVGALVGMDDENAGGSVGFRILGDGKE
LAATGVMHPGDRAQALSAQLTGVQVLELSVTDAGDGNTNDHADWANATITC
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgcgatagccgcctgcacctcggtggtcacggtcgccgaagccgtccccgcc
gcagccgcggagccgggttacttcgctgcccagcgcgtcggcgaacggccgccgatgggc
tggaacagctggaacaggttcggctgcgacatcaacgaggacctcgtccgcggtgccgcc
gacgcactggtgtcgtccggcatgaaggacgcgggctaccagtacatcaacatcgacgac
tgctgggcggaacagaatcgcacggccgagggcaagctcgaacccagccacgaacgcttc
ccacacggcatcaagaccctcgccgactacgtccacgggctcggcctgaagctcggcatc
tacaccagcgccggcacactgacctgccagaagaccatgcccggcgcgctcgaccacgag
gaggcggacgcgcagtccttcgccgattggggcgtcgactatctcaagtacgacaattgc
aacaaccagggtcgaccggcgatcgagcgctacacgaagatgggcgacgcgatcaagaag
accggccgcccgatgatctacgccctctgcgaatggggcgagaacaagccgtggacctgg
gggcgcgacgccggtgcgcagctgtggcgcaccaccggcgacatcagcgacaactggggc
agcatgaccggcatcctcgaccagcaggtcggcctggaaaagttcgcgggccccggcggc
tggaacgacccggacatgctcgaagtcggcaacggcggcatgaccgacaccgagtaccgg
tcgcacttcgcgctgtgggcgctcctgaacgcgccgctgctggccgggaacgacctgccc
gcgatgtcgcccgccaccaaggcgatcctcgagaacaacgacgtcatcgcgctggaccag
gactgggccggcacacagggccgcaagctccgcgacgacggcgacaccgaggtctgggcg
aagccgatgtccgatggatcggccgcggtagtgctcttcaaccgtgggtcggcgagcacg
accatcagcaccacggcggcggaactcggtctcgagggccacaccttccgcgtccgcgac
ctctggaccggcacggaaaccgaaaccgcgggcaccctccgcgacgccgtcgcgtcccac
gactcgtccgtcttccgggtctggccgtcgacgcacccgtcggccgcgccgatgacgacg
ctggccctgccggcgccggactacgtgcccgccgaccgcccgctgaccaccacccttcag
gtcatcaacgacggcagcacgccgatcacccagctccgggccaccgtcgcgacgcccgtc
ggctggcagctcgacggccccggcacgttcacggttccggccgtacccccggggaagtcg
tggcagcagcagatcacgttcaagccggtggcgccgggtggcgagcgcgtcaggctggcg
gccaaagccgactactccaccgcgtggggcaagcgcgccttgggctcggaaggcacgtcg
ccgctcgtctcccgcccgtcgtccggcacgacggcgttgtcaaaggccccgtggatgtcg
tccgacaacggctggggcccggtcgaacgcggcacgagcaacggcgagagccagcctggt
gacggccaccggatcaccatcgccggggtcggctacgacgacggcatcggtgcccacgcc
ccctcgagcgtgcgggtctacgtcggcgcatcctgcacgtccgtcggcgccctggtcggg
atggacgacgagaacgccggtggcagcgtggggttccgcatcctcggtgacggcaaggaa
ctcgccgcgacgggcgtcatgcaccccggagacagggcacaggcgctgtccgcacagctg
accggcgtccaggtgctggaactgtcggtgaccgacgccggcgacggcaacaccaacgat
cacgccgactgggcgaacgccacgatcacctgctga

DBGET integrated database retrieval system