KEGG   Amycolatopsis mediterranei S699: AMES_3943Help
Entry
AMES_3943         CDS       T02190                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMES_3943
Enzymes [BR:amm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AMES_3943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4360951..4362294)
Genome map
AA seq 447 aa AA seqDB search
MAAGGLAAVAVTAVVATTTGAGAQAAASAYYVDPGTNAAKWVAANPGDSRAAVIRDRIAS
VPQARWFTTTNTSTVRGEVDAYTGAAAAAGKIPIMVVYDIPNRDCGGASSGGAPSQDAYR
AWIDQVAAGLSGRPAAIVLEPDVLPQMTNCQNSDQQRQTTASLAYAGKRLKAGSSQAKVY
FDIGHSAWLSPGDAATRLRAADISNSADGISTNVSNYRATADEVAYDKAILGQLGDSRLK
AVIDTSRNGNGPQGSEWCDPGGRAIGTPSTNQTGDGQIDAFLWIKPPGEADGCIATAGQF
VPQRAYDLAVAAGPVTTTPTTPTTPTTPTTPTTPSTPTTTTPQPTGGCKVTHRVVSSWPT
GYTGEIVIENRGAALTGWTLTFSAPGVTVSQGWNGTWTDNGDTVKVDNVSWNGNLGTGAT
VTLGYNADYTGSTPPFLQPALNGTYCS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtggcagccggtggactggccgcggtggccgtgaccgccgtcgtcgccacgaccaccggg
gccggcgcgcaggccgccgcctcggcgtactacgtcgacccgggcaccaacgcggccaag
tgggtcgcggcgaaccccggcgactcccgggccgcggtcatccgcgaccgcatcgcctcg
gtaccgcaggcgcggtggttcaccaccaccaacacgtccacggtccgtggtgaggtggac
gcctacaccggcgcggcggccgccgcgggcaagatcccgatcatggtcgtctacgacatc
ccgaaccgcgactgcggcggcgcgagcagcggcggcgcgccgtcccaagacgcctaccgg
gcctggatcgaccaggtggcagccgggctgtcgggccggcccgcggccatcgtgctcgag
cccgacgtgctcccgcagatgacgaactgtcagaacagcgaccagcagcgccagaccacg
gcgtcactcgcgtacgcgggcaagcggctcaaggccggctcctcccaggcgaaggtgtac
ttcgacatcgggcactccgcctggctttcccccggtgacgccgcgacgcggctgcgggcc
gccgacatctcgaacagcgccgacggcatctcgaccaacgtgtcgaactaccgcgcgacc
gccgacgaagtggcctacgacaaggcgatcctcggccagctcggcgactcgcggctgaaa
gcggtgatcgacacgagccgcaacggcaacgggccgcagggcagcgagtggtgcgacccg
ggcgggcgcgcgatcggtacgccgagcaccaaccagaccggcgacggccagatcgacgcg
ttcctgtggatcaagccgccgggcgaggcggacggctgcatcgccacggcaggccagttc
gtgccccagcgggcctacgacctcgccgtcgcggccgggccggtcacgaccaccccgacg
acgccgaccacgccgacgacccccaccacgccgaccacgccctcgaccccgaccaccacg
accccgcagccgaccggcggctgcaaggtcacccaccgggtggtcagctcctggccgacc
gggtacaccggggagatcgtcatcgaaaaccgcggcgcggccctcaccggctggacgctg
acgttctccgcacccggcgtgacggtcagccagggctggaacgggacctggaccgacaac
ggcgacaccgtcaaggtcgacaacgtgtcgtggaacggcaacctgggcacgggcgcgacg
gtcaccctcggctacaacgcggactacaccggcagcacgccgccgttcctgcagccggcg
ctgaacgggacctactgctcctga

DBGET integrated database retrieval system