KEGG   Amycolatopsis mediterranei S699: AMES_4139Help
Entry
AMES_4139         CDS       T02190                                 

Gene name
lig
Definition
ATP-dependent DNA ligase
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:amm03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:amm03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:amm03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:amm03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4607995..4609572
Genome map
AA seq 525 aa AA seqDB search
MAADPARKLRRYQEMRDFGRTAEPAGGSAGPDGHRFVVQRHRARRLHYDFRLELGGVLVS
WAVPKGPTLDPKARRLAVHVEDHPIEYAGFEGVIPRGEYGGGDVIVWDRGVWRPVEPDPA
RAIEAGTLHFDLEGEKLAGRFVLVRTSRGEKDQWFLLHKQDEHAQAGWDAEDHPRSVKSG
RTNDEVAAAPDALWHGDRPAAEAEESVGGWQAPTEDELAALDALGVKGRWSVAGRELALT
NLDKVLFPAAGGGKPVTKRDLIRYYATVGPVMLPYLAGRPLNTHRFPQGVTEPGFWQKEV
PRHAPDWLTTWRNERAEPGESRRYVVADSVATLAWLANYGALELHAWTSRAADVDHPTWV
LFDIDPGPETTFEEVLELARLHRTALEHLGLTGRPKVTGQRGIQVWVPIAPHCTFEQTRA
WAETVSRTIGRVLPDLVSWAWTKDKRRGRARLDYTQNVLNKTLVAPYSVRPRPGAPVSVP
LEWAELDDPRLAPDRWTIRDVPGRLAEHGDPFSVLLGLEQKLPGL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagacccggcccgcaaactgcggcgctaccaggagatgcgcgacttcggccgt
accgcggagccggccggcgggtccgccggtccggacggccaccggttcgtggtgcagcgg
caccgcgcgcgccggttgcactacgacttccgcctcgaactcggcggcgtgctggtcagc
tgggcggtgccgaagggcccgacgctggacccgaaggcccgccggctggccgtgcacgtc
gaagatcacccgatcgagtacgccgggttcgagggcgtcatcccgcgcggcgagtacggc
ggcggggacgtcatcgtctgggaccgcggcgtctggcggccggtcgaacccgacccggcg
cgcgcgatcgaggccgggacgctgcacttcgacctcgaaggcgagaagctggccgggcgg
ttcgtcctcgtccgcaccagccgcggcgagaaggaccagtggttcctcctgcacaagcag
gacgagcacgcgcaggccggctgggacgccgaggaccacccgcgctcggtgaagagcggc
cgcaccaacgacgaggtcgcggccgctcccgacgccttgtggcacggcgaccgtccggcc
gccgaggcggaggagtccgtcggcggctggcaggccccgaccgaagacgaactggccgcc
ctcgacgccctgggcgtcaagggccggtggtcggtggcgggccgcgagctggcgctgacc
aacctggacaaggtgctcttcccggcggccggtggcgggaagccggtgaccaagcgggac
ctcatccggtactacgccaccgtcggcccggtcatgctgccgtacctggccggccgcccg
ctcaacacccaccggttcccccagggcgtcaccgagccgggcttctggcagaaggaggtc
ccgcggcacgcgcccgattggctgaccacgtggcgcaacgagcgcgccgagccgggggag
agccggcggtacgtcgtcgccgacagcgtcgcgaccctggcctggctggcgaactacggc
gcgctggagctgcacgcctggacttcccgcgccgccgacgtcgaccacccgacgtgggtg
ctgttcgacatcgacccgggcccggagacgacgttcgaggaggtcctggagctggcgcgg
ctgcaccgcaccgcgctcgagcacctgggcctcaccggacggcccaaggtgaccgggcag
cgcggcatccaggtgtgggtgccgatcgccccgcactgcacgttcgagcagacccgcgcg
tgggcggagacggtgtcccggacgatcgggcgggtgctgcccgacctggtcagctgggcc
tggacgaaggacaagcgccgcggccgcgcccggctggactacacgcagaacgtgctgaac
aagacgctcgtcgcgccctacagcgtccgtccgcggcccggcgcgccggtttcggtgccg
ctggagtgggccgagctggacgacccgcggctcgcgcccgaccggtggacgatccgggac
gtccccggccgcctggctgagcacggagacccgttctcggtgctgctcggtctcgaacag
aagctgccgggcctgtag

DBGET integrated database retrieval system