KEGG   Amycolatopsis mediterranei S699: AMES_4169Help
Entry
AMES_4169         CDS       T02190                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00360  Phenylalanine metabolism
amm00362  Benzoate degradation
amm00620  Pyruvate metabolism
amm00621  Dioxin degradation
amm00622  Xylene degradation
amm00650  Butanoate metabolism
amm01100  Metabolic pathways
amm01120  Microbial metabolism in diverse environments
amm01220  Degradation of aromatic compounds
Module
amm_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMES_4169 (mhpF)
   00650 Butanoate metabolism
    AMES_4169 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    AMES_4169 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMES_4169 (mhpF)
   00622 Xylene degradation
    AMES_4169 (mhpF)
   00621 Dioxin degradation
    AMES_4169 (mhpF)
Enzymes [BR:amm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AMES_4169 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFO77705
Position
4634686..4635585
Genome map
AA seq 299 aa AA seqDB search
MAPVMAAIVGPGNIGTDLLAKLRRSEVIEVGYVVGVVESDGLERARAQGIAASADGVDWL
LRQDPVPQLVFEATSAKAHAANAPRYAEAGIQAIDLTPAHLGPMVCPPVNLGAHLDAPNV
SMITCGGQATIPMVHAVSRVTAVPYAEIVASVASRGAGPGTRANIDEFTRTTSQAVAEIG
GAGRGKAIIILNPVEPPMIMRDTVFCAIGLDADRDAITASIHEMADEVRKYVPGYSLRAD
PQFDDAREEWDGHARVGIFLEVRGNGDYLPEYAGNLDIMTAAAARVGELMARAKQEVPA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgtgatggcggcgatcgtcggccccggcaacatcggcaccgatttgctggcg
aagctgcgacgcagtgaagtgatcgaagtcggttacgtggtcggcgtggtcgagtcggac
ggtctcgagcgcgcccgcgcgcaggggatcgcggcgtccgcggacggcgtcgactggctg
ctgcgccaggatcccgtgccccagctcgtgttcgaagcgacgtcggcgaaggcgcacgcc
gcgaacgcgccgcggtacgccgaagccggcatccaggcgatcgacctgaccccggcgcac
ctcggcccgatggtgtgcccgccggtgaacctcggcgcgcacctcgacgcgccgaacgtt
tcgatgatcacctgcggcggccaggccacgatccccatggtgcacgccgtttcgcgggtg
accgcggtcccgtacgccgagatcgtcgcctcggtcgcttcgcggggagcgggccccggg
acgcgggcgaacatcgacgagttcacgcgcacgacgtcgcaggcggtggccgagatcggc
ggtgccgggcgcggcaaggcgatcatcatcctcaacccggtcgagccgccgatgatcatg
cgggacacggtgttctgcgcgatcggcctcgacgccgaccgcgacgcgatcaccgcgtcg
atccacgagatggccgacgaagtccgcaagtacgtgccggggtattcgctgcgggcggac
ccgcagttcgacgacgcacgcgaggaatgggacgggcacgcgcgggtcggcatcttcctc
gaggtccgcggcaacggcgactacctgcccgagtacgccgggaacctggacatcatgacc
gccgcggccgcccgcgtgggcgagctgatggcccgcgcgaagcaggaggtgccggcatga

DBGET integrated database retrieval system