KEGG   Amycolatopsis mediterranei S699: AMES_4313Help
Entry
AMES_4313         CDS       T02190                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:amm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:amm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4785959..4787416
Genome map
AA seq 485 aa AA seqDB search
MSTPATQSSPEKLAEAVLLPGFAGTTAPDWLRRRIAGGLGGVVLFGRNVVDDEQVAALTA
QLRGERDGVVVGIDEEGGDVTRLDVNTGSFVPGPLALGAADDPELTTAVAAALGERLAAC
GVTLNLAPCADLTLAAEDPIIGVRAFGSDPAKASPHVAAYVTGLQKYGVAACAKHFPGHG
AATEDSHVALPVLPRTVEELHEIELVPFAAAIRAGVRSVMSGHLVVRAWGDEPATLNRTA
LTDVLRGELGFTGAVITDALEMGAVSGAYGRHDGLGRSAVRALAAGADALCLGGAAFEAE
HLDACVAAIVAAVAAGELRLERLAEAAARTAALGTDPAPASVGPVDRRLGLEAARKALRV
QGEPRLAGPPLVVDVQTEPTIAAGPMPWGLGAHLAELVPGTRALTVTPDDADVVLEAAPG
FRSVVVVTREAHRHPRVRALLTALSGLDFIRVETGVPGPDGDGGARIDTFSGSWVSLRAA
AEHLA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
ttgtccacgccagcgacgcagtcctcgcccgagaagctcgccgaagccgtcctcctgccc
gggttcgccgggacgaccgcgccggactggctgcgccgccggatcgccggcggcctgggc
ggggtggtgctgttcggccgcaacgtcgtcgacgacgagcaggtcgccgcgttgaccgcg
cagctgcggggggagcgcgacggggtcgttgtcgggatcgacgaagagggcggcgacgtc
acccgcctcgacgtgaacaccgggtcgttcgtgccgggcccgctcgccctgggcgcggcg
gacgacccggagctgaccaccgccgtcgcggccgcgctcggtgagcggctggccgcgtgc
ggcgtcacgctgaacctggcgccgtgtgcggacctgaccctggccgccgaggacccgatc
atcggcgtccgggcgttcgggtccgacccggcgaaagcgtcgccgcacgtcgcggcgtac
gtgaccggcctgcagaagtacggcgtcgcggcgtgcgcgaagcactttccgggccacggc
gcggcgaccgaggactcgcacgtggcgctgccggtgctgccccgcacggtcgaggagctg
cacgagatcgaactggtcccgttcgccgcggcgatccgggccggcgtccgctcggtcatg
tcgggccacctggtcgtccgcgcctggggcgacgagccggccacgctcaaccggaccgcg
ctcaccgacgtcctgcgcggcgagctcggcttcaccggcgcggtgatcaccgacgccctc
gagatgggcgcggtgtccggcgcgtacgggcgccacgacggtctgggccgctcggccgtg
cgggccctggccgcgggggcggacgcgctgtgcctcggcggcgcggcgttcgaggccgag
cacctggacgcctgcgtcgcggcgatcgtggccgcggtcgcggcgggggagctgcgcctg
gagcggctggccgaggcggcggcgcggacggcggcgctgggcaccgacccggcgccggct
tcggtggggccggtcgaccggcggctcggcctggaggcggcccgcaaggcgctgcgggtc
cagggcgagccgagactggccgggccgccgctcgtggtcgacgtccagaccgagccgacc
atcgcggccggcccgatgccgtggggcctcggcgcgcacctggccgagctcgtgccgggc
acccgggcgctgaccgtgacccccgacgacgccgacgtggtgctcgaggcggcgccgggg
ttccgcagcgtcgtcgtcgtgacgcgggaagcgcaccggcacccgcgggtgcgcgcgctg
ctcaccgccctgtccggcctggatttcatccgggtggagacgggcgtgcccggacccgac
ggcgacggcggtgcgcggatcgacacgttcagcggctcctgggtcagcctgcgtgcggcg
gccgagcacctggcctga

DBGET integrated database retrieval system