KEGG   Amycolatopsis mediterranei S699: AMES_4330Help
Entry
AMES_4330         CDS       T02190                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4806649..4807269)
Genome map
AA seq 206 aa AA seqDB search
MSVDPVSAPVPLRHLGVVHNRDTVDLDAAERAVADLLRALGKDPSSEHLGDTPRRVAHAY
AEMLQPRDFQLTTFPNDEGYDELVLAKSIPVQSLCEHHLLPFRGVAHVGYLPGERILGLS
KLARVVEMFARDLQVQERLTKQVADWLQEHLAPKGVGVVIEAEHLCMSLRGVRASGALTV
TSSLHGLLREEPKTRQEFFALSGVSA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcgatcccgtcagcgccccggtcccgctgcggcacctcggtgtcgtccacaac
cgcgacaccgtcgacctggacgcggccgaacgcgcggtcgccgacctgctgcgggcgctc
gggaaggacccgtcgtcggagcacctcggcgacacgccgcggcgggtggcccacgcctac
gcggagatgctgcagccgcgcgacttccagctgacgaccttccccaacgacgagggctac
gacgagctcgtgctggcgaagagcatcccggtgcagtcgctgtgcgagcaccacctgctg
cccttccgcggcgtcgcccacgtcggctacctgcccggcgagcggatcctcgggctgtcc
aagctcgcccgggtcgtcgagatgttcgcgcgcgacctgcaggtgcaggagcggttgacc
aagcaggtcgcggactggctgcaggagcacctggcgccgaagggcgtcggcgtcgtgatc
gaggccgagcacctgtgcatgtccctgcgcggggtgcgggcgagcggcgcgctgaccgtg
acgtcgtcgctgcacggcctgctgcgggaagaacccaagacgcggcaggagttcttcgcc
ctgagcggggtgagcgcgtga

DBGET integrated database retrieval system