KEGG   Amycolatopsis mediterranei S699: AMES_4460Help
Entry
AMES_4460         CDS       T02190                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
amm  Amycolatopsis mediterranei S699
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4967387..4968340
Genome map
AA seq 317 aa AA seqDB search
MWQAPAASASVPLQYTTNRYVGSAVAAAYLASETDYRAVLTREFDNVTPENEMKWGTVEA
VRGQYDWSGADAIVEYARTHHKTVRGHTLVWHSQLPDWVGALPADELRRVLHDHITTEVK
RYKGKIRAWDVVNEIFNEDGTRRDTVFRQKLGDGFVADVFRWAHAADPAAKLYLNDYNIE
GINPKSDAVYDLVKTLRRQGVPISGVGIQGHLSIQYGFPGQYRENLARFARIGVETAVTE
ADVRIPTPPDAAKLATQASYFGQLWDGCHAVRKCVEFTTWGFTDRHSWVPDVFPGEGAAC
LFDENLRPKPAYFRLNP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgtggcaggcgcctgcggcatcggcgtcggtgccgctgcaatacaccacgaaccgttac
gtcggcagcgcggtggccgcggcgtacctggcttcggaaaccgattaccgggcggtgctc
acgcgagaattcgacaacgtgacgccggagaacgagatgaagtggggcacggtcgaagcc
gtgcgcggccagtacgactggtccggcgcggacgcgatcgtcgagtacgcgcggacgcac
cacaagaccgtgcgcggccacacgctggtctggcactcccagctcccggactgggtcggc
gcgctgcccgccgacgagctccgccgggtcctgcacgaccacatcaccacggaagtcaag
cggtacaagggaaagatccgcgcctgggacgtcgtcaacgagatcttcaacgaggacggc
acccgtcgcgacacggtcttccggcagaagctcggcgacggcttcgtcgccgacgtcttc
cgctgggcgcacgcggccgacccggcggcgaagctctacctcaacgactacaacatcgaa
gggatcaacccgaagagcgacgcggtgtacgacctggtgaagacgctgcggcggcagggc
gtgccgatcagcggcgtcggcatccagggacacctgtcgatccagtacggcttcccgggt
cagtaccgggagaacctggcgcgcttcgccaggatcggcgtggagaccgcggtcaccgag
gcggacgtccggatcccgaccccgccggacgcggccaagctcgccacccaggcgagctac
ttcggtcagctgtgggacggctgccacgccgtccgcaagtgcgtcgagttcacgacctgg
ggtttcaccgaccggcactcgtgggtcccggacgtcttcccgggtgaaggcgcggcctgc
ctgttcgacgagaacctgcgcccgaagccggcgtacttccgcctcaacccctga

DBGET integrated database retrieval system