KEGG   Amycolatopsis mediterranei S699: AMES_4545Help
Entry
AMES_4545         CDS       T02190                                 

Gene name
glsA
Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00220  Arginine biosynthesis
amm00250  Alanine, aspartate and glutamate metabolism
amm00471  D-Glutamine and D-glutamate metabolism
amm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMES_4545 (glsA)
   00220 Arginine biosynthesis
    AMES_4545 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AMES_4545 (glsA)
Enzymes [BR:amm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     AMES_4545 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AFO78081
UniProt: G0FML9
Position
5071126..5072031
Genome map
AA seq 301 aa AA seqDB search
MDLAALLDRIADDVAPEVGRGAVADYIPALARVAPGRFGMAVAEVDGAVHGVGDWEHPFS
VQSMSKVFTLALTLSRGDDVWARVGREPSGDPFNSLVQLEHEDGIPRNPFINAGALVVTD
ELARHGDAVDALLAFLRQESGRAGIAVDPEVAASEAGHADRNRALAYFMASYGNMRHPVP
SVLDQYVRQCSIAMSCADVARSALFLARHGVRNDGSRLLGLSAAKRINAVMLTCGTYDAA
GEFAYRVGLPGKSGVGGGVLAIVPGRCAVCVWSPGLDARGNSVAGVAALDRFTTLTGWSI
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggacctcgcggcgctgctggaccggatagccgacgacgtcgcgcccgaggtcggccgc
ggcgccgtcgctgactacattcccgcgctggccagggtggcgccggggcggttcggcatg
gcggtggccgaagtggacggtgcggtgcacggcgtcggcgactgggagcacccgttctcc
gtgcagagcatgtccaaagtgttcaccctcgcgctgaccctttcccgcggcgacgacgtg
tgggcgcgggtcggccgcgaaccgtcgggtgatccgttcaattcgctggtgcagctcgaa
cacgaggacggcattccgcgcaacccgttcatcaatgcgggcgcgctggtggtgaccgac
gaactcgcccgccacggcgacgcggtggacgcgctgctcgccttcctccggcaggagagc
ggccgtgcggggatcgccgtggatcccgaggtggcggcgtcggaggcggggcacgccgac
cgcaaccgcgccctcgcgtacttcatggcgtcctacggcaacatgcgccacccggtgccg
tcggtgctggaccagtacgtccgccagtgttcgatcgcgatgagctgcgccgacgtcgcc
cggtcggcgttgttcctggcccgccacggcgtccgcaacgacggctcgcggctgctcggg
ctgagcgcggcgaagcggatcaacgcggtgatgctgacgtgcggcacgtacgacgcggcg
ggcgagttcgcctaccgcgtcggcctcccgggcaagagcggcgtgggcggcggcgtcctg
gcgatcgtcccgggccggtgcgcggtctgcgtgtggagccccgggctggacgcgcgcggc
aactccgtggccggtgtggcggccctggaccggttcacgacgctgaccggctggtcgatc
ttctga

DBGET integrated database retrieval system