KEGG   Amycolatopsis mediterranei S699: AMES_5513Help
Entry
AMES_5513         CDS       T02190                                 

Gene name
desC
Definition
stearoyl/acyl-CoA desaturase (delta-9 desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AMES_5513 (desC)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AMES_5513 (desC)
Enzymes [BR:amm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AMES_5513 (desC)
Lipid biosynthesis proteins [BR:amm01004]
 Desaturase
  First
   AMES_5513 (desC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6198804..6199403)
Genome map
AA seq 199 aa AA seqDB search
MPRPPKAAEPMLAGEKSRTETFLVKLFAVVPLLAPAGAVPFAWGWGLGWTDVALSVGFSF
LTGLGVTIGFHRHFTHGAFKAGRGLRIALAVTGSMAMRGPVIGWVADHRRHHAYADRDGD
PHSPWRYGTSAAALAKGFWHAHMGWLFDREKTNAQRFAPDLLADRDIVRIDRWFPALTVV
TLLSPALIGGLVTMSWWVR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgccacggccgccgaaggcggcggagccgatgctcgcgggggagaagtcccgcaccgaa
acctttctggtcaagttgttcgcggtggtgccgttgctggcgccggccggggcggtgccg
ttcgcgtggggctggggcctcgggtggaccgatgtcgccctgtcggtcgggttctccttc
ctgacggggctcggggtgacgatcgggttccaccggcacttcacccacggcgcgttcaag
gccggccgcggcctgcggatcgcgctcgcggtcaccggcagcatggccatgcggggcccg
gtgatcggctgggtcgccgaccaccgccgccaccacgcctacgccgaccgcgacggtgat
ccgcactccccgtggcgctacggcacgtccgccgccgcgctcgccaaaggcttctggcac
gcccacatgggctggttgttcgaccgcgagaagaccaacgcgcagcggttcgcccccgac
ctgctcgccgaccgcgacatcgtccggatcgaccgctggttccccgcgctcaccgtggtc
accctgctcagcccggcactgatcggcggcctggtgacgatgtcctggtgggtgcgctga

DBGET integrated database retrieval system