KEGG   Amycolatopsis mediterranei S699: AMES_6166Help
Entry
AMES_6166         CDS       T02190                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:amm00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:amm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6940299..6941843)
Genome map
AA seq 514 aa AA seqDB search
MKAVPAPPRPARIDPVPLATLLARADARLIAGSPDAAELTVTGTTLRAQHVLPGDLFAAL
PGARAHGADFSDQAVAAGAVAVLTDAAGAERPALRDAGVPILVHPDPRAALGEIAAWIYG
EPSLELSVLGVTGTSGKTTTSYLVDAGLQAAGLTTGLIGTVETRIAGDRLVSGFTTPEAP
DLQALLAVMLERGVTHVPMEVSSHALALGRVNGTRFAVGAFTNLSQDHLDFHKDMQEYFA
AKSLLFDGRSTHEVVVVDSAWGQALLTPQTITVTTDPGTEAAWKATDLEATPQGEQTFTL
HGPDGARAAARIPLPGEFNVANAVLAAAILSTAGVSLEHIVAGLAQVQVPGRMERVHVGQ
EFTAVVDYAHKPAAVAQGLDALRARTEGRIITVLGCGGDRDTAKRPIMGEAAARRSDVLI
VTDDNPRSEDPAAIRAAMLAGARSVGPAEGGEILEIGDRREAIAHAVSLAGPGDIVFLAG
KGHESGQEAGGVVHPFSDRDELAAAIRNKLEVSV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcggtccccgcgccgccccgccccgcgcgcatcgacccggtcccgctggcgacg
ctgctcgccagggcggacgcccgcctgatcgccggttcgcccgacgcggccgagctcacc
gtcaccggcaccacgctgcgtgcccagcacgtgctgcccggcgacctcttcgccgccctc
ccgggcgcccgcgcccacggcgccgacttcagcgaccaggccgtcgcggccggggccgtc
gccgtcctcaccgacgccgccggcgccgagcgccccgccctgcgcgacgccggcgtgccg
atcctggtgcacccggacccgcgggcggctctcggcgagatcgccgcctggatctacggc
gagccctccctggagctgtccgtgctcggcgtcaccggcacctccggcaagacgacgacg
tcgtacctggtcgacgccgggttgcaggccgccgggctgaccaccgggctgatcggcacg
gtggagacccggatcgcgggcgaccggctggtcagcggcttcaccacgccggaggcgccc
gacctgcaggccctgctcgcggtgatgctcgagcgcggcgtcacgcacgtgccgatggag
gtctccagccacgcgctcgcgctgggccgcgtcaacggcacccggttcgcggtcggcgcg
ttcaccaacctctcccaggaccacctggacttccacaaggacatgcaggagtacttcgcc
gcgaagtccctgctgttcgacggccgctcgacgcacgaggtcgtcgtggtcgacagcgcg
tggggccaggccctgctcacgccgcagacgatcaccgtgaccaccgatccgggcaccgag
gccgcgtggaaggccaccgacctggaggccaccccgcagggcgagcagacgttcaccctg
cacggcccggacggggcccgcgcggccgcccggatcccgctgcccggcgagttcaacgtc
gccaacgccgtgctggcggccgcgatcctgagcaccgccggggtgtcgctggagcacatc
gtcgccggcctcgcccaggtgcaggtcccgggccggatggagcgcgtccacgtcggccag
gagttcaccgccgtcgtcgactacgcccacaagccggccgcggtcgcccagggcctcgac
gcgctgcgggcccgcaccgagggccggatcatcaccgtgctcggctgcggcggcgaccgg
gacaccgccaagcgcccgatcatgggcgaggccgcggcccgccgcagtgacgtcctgatc
gtcaccgacgacaacccgcgctccgaagatccggcggcgatccgcgccgccatgctcgcc
ggcgcccgatcggtcggccccgccgagggcggcgagatcctcgagatcggcgaccgccgc
gaggccatcgcgcacgccgtctcgctcgccgggccgggtgacatcgtcttcctcgccggc
aaggggcacgagtccggccaggaggccggcggcgtcgtgcacccgttctccgaccgcgac
gagctggccgcggccatccgcaacaaactcgaggtgagtgtgtga

DBGET integrated database retrieval system