KEGG   Amycolatopsis mediterranei S699: AMES_6464Help
Entry
AMES_6464         CDS       T02190                                 

Definition
threonine dehydrogenase and related Zn-dependent dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:amm01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:amm00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:amm00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7252154..7253290)
Genome map
AA seq 378 aa AA seqDB search
MKAVVYQGPRSVEVREVPEPKIEQPADAIVKITTTNICGSDLHMYEGRTNVEEGKILGHE
NMGFVAEIGSGVTRIKVGDRVSVPFNIACGTCRNCLEGWTSFCLRANPTEGVDGAAYGYA
NMGPYDGGQAEYLRVPWADFNLLELPGGTEHENDFTMLSDIFPTGWHGTELAGMRPGDRV
VVFGAGPVGLLAAHSAVIRGAAEVYVVDKERDRLAMAEKIGTIPIDLSEADPVEQIMAAT
GGAGADCGVEAVGYQAHDHTGEEHPELVLDNLVKTVRSTGGIGVVGVSLPDDPGAANELA
KHGRIAFDYGSLFMKGQHMGTGQAPVKRYNRQLRDLIITGKANPSFLVSHELPLDQAAEG
YEKFDHRDDGWTKVLLRP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtggtgtaccaaggaccgcgcagcgtcgaggtgcgtgaagtcccggaaccg
aagatcgagcagccggccgacgcgatcgtcaagatcaccacgacgaacatctgcgggtcg
gacctgcacatgtacgaaggccgcacgaacgtcgaagaaggcaagatcctcggccacgaa
aacatgggcttcgtcgccgaaatcgggtccggggtcacccggatcaaggtcggtgaccgg
gtgtcggtgccgttcaacatcgcctgcgggacctgtcgcaactgcctcgagggctggacg
tcgttctgcctgcgcgccaaccccaccgagggagtcgacggtgccgcctacggctacgcg
aacatgggcccatatgacggtggtcaggcggagtacctgcgcgtgccgtgggcggatttc
aacctgctggagctgcccgggggcaccgagcacgagaacgacttcaccatgttgtcggac
atcttcccgaccggctggcacggcaccgagctggccgggatgcgtcccggtgaccgggtc
gtggtgttcggcgccgggccggtcgggctgctggccgcgcacagcgcggtgatccggggt
gcggccgaggtctacgtcgtggacaaggaacgtgaccggctggccatggccgagaagatc
ggcaccatcccgatcgacctgtccgaggccgaccccgtcgagcagatcatggccgcgacc
ggcggcgcgggcgccgactgcggcgtcgaggcggtgggctaccaggcgcacgaccacacc
ggcgaagagcacccggagctggtgctggacaacctggtcaagacggtgcgttcgaccggc
ggcatcggcgtggtcggggtgtccctgccggacgacccgggcgcggcgaacgaactggcc
aagcacggccggatcgccttcgactacggcagcctcttcatgaagggccagcacatgggc
accggccaggccccggtcaagcgctacaaccggcagctgcgcgacctcatcatcaccggg
aaggcgaacccgtcgttcctggtctcgcacgagctgccgctggatcaggccgcggagggc
tacgagaagttcgaccaccgcgacgacggctggaccaaggtcctgttgcgaccgtga

DBGET integrated database retrieval system