KEGG   Amycolatopsis mediterranei S699: AMES_6588Help
Entry
AMES_6588         CDS       T02190                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMES_6588 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMES_6588 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AMES_6588 (thrC)
Enzymes [BR:amm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AMES_6588 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7375332..7376597
Genome map
AA seq 421 aa AA seqDB search
MTATLGTTSTTKTPDLGPAVELVSKEEGHRQPLAPEFVSAEDFSPLEVAYDFGRVRREDI
EAGPKNIWRYKKLLPVPSNVEEIPNTEPGATRLVRADRLAKELGLKRVWVKDDTGNPTHS
FKDRVVAVALAAAREFGFEVLACPSTGNLANATAAAAARAGWRSVVLIPKSLERAKILTT
AVYDGDLIAIDGNYDDVNRLATELAGEHPKWAFVNVNVRPYYSEGSKTLAFEVAEQLGWR
IPPQIVVPIASGSQLTKVDKGFRELGQLGLVDASPYKVFGAQATGCSPVSAAFRAGQDVV
QPVKPDTIARSLAIGNPADGPYVLDIVNRTGGAIEDVSDEEVVEGIRLLARTEGIFTETA
GGVTVATAKKLVETGKLDPDAETVLLITGDGLKTLDAIENHVGPKATLPPSAAAVNKALG
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccctcggcacgacctccaccaccaagaccccggatctcggacccgccgtc
gagctggtgtcgaaggaagagggccaccggcagccgctcgctccggagttcgtctccgcc
gaagacttctcaccgctcgaggtcgcctacgacttcggccgcgtccgccgcgaagacatc
gaagccggccccaagaacatctggcgctacaagaaactccttcccgttccgtccaacgtc
gaagagatcccgaacaccgagccgggcgcgacgcgcctggtccgcgccgaccgcctcgcc
aaggaactcggcctcaagcgcgtgtgggtcaaggacgacaccggcaacccgacgcactcg
ttcaaggaccgcgtcgtcgccgtcgcgctggccgcggcccgcgagttcggtttcgaggtg
ctcgcgtgtccctcgaccggcaacctggccaacgcgacggccgccgccgcggcccgcgcc
ggctggcggtcggtcgtgctgatccccaagtctctcgagcgcgccaagatcctcaccacc
gcggtgtacgacggcgacctcatcgccatcgacggtaactacgacgacgtcaaccgcctc
gccaccgagctcgccggcgagcacccgaagtgggcgttcgtcaacgtgaacgtccggccg
tactactcggagggctcgaagacgctggccttcgaggtcgccgagcagctcggctggcgc
atcccgccgcagatcgtcgtgccgatcgcctccggttcgcagctgaccaaggtggacaag
ggtttccgtgagctggggcagctcggtctcgtggacgccagcccgtacaaggtgttcggc
gcgcaggccaccggctgctcgccggtgtcggccgcgttccgcgccggccaggacgtggtc
cagccggtgaagccggacacgatcgcccgctcgctggcgatcggcaacccggccgacggc
ccgtacgtgctcgacatcgtcaaccgcaccggcggcgcgatcgaggacgtctccgacgaa
gaggtcgtcgagggcatccgcctgctggcccgcaccgaaggcatcttcaccgagacggcc
ggcggggtcaccgtcgccacggcaaagaagctggtcgagacgggcaagctggacccggac
gccgagaccgtgctgctcatcaccggcgacggcctcaagaccctcgacgcgatcgagaac
cacgtcggccccaaggcgaccctgccgccctcggccgcagccgtgaacaaggccctcggc
tactga

DBGET integrated database retrieval system