KEGG   Amycolatopsis mediterranei S699: AMES_6616Help
Entry
AMES_6616         CDS       T02190                                 

Gene name
phoD
Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amm00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:amm00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:amm02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7407399..7408955)
Genome map
AA seq 518 aa AA seqDB search
MTEPTHHSRRTLLKAGLTGASAVAAGLVVPSTAFAAVPLVRRDRPVLTHGVQSGDVTPGS
AIVWSRADRPSRLVVEIARDPSFRHARRVPGPQVGPDSGGTGRVRVAALQPGTEYHYRVT
AEALDGRATSEPLTGRFATAPVGRRDARILWSGDVVGQNWGINPGLGGMTIFSAMAARCP
DLFLHSGDTVYSDGPLTETVTLPGGRTWRNIVTPEKSKVAETLDEFRGQHAYNRLDDNFK
RFAAQVPAYVQWDDHEVLNNWYPGKILDNPAYTEKRVDVLAPRAYQAFHEWHPIDSRRAV
DGRVYRSFTYGSRVEIFVLDMRTYRNANTADRTKPGYILGDAQARWLADALGRSTATWKI
VQADMPLGLVVPDGANIEAVANNLPGAPGGRETELAWVLREIQRRRVRNVVWLTADVHYT
AAHHYSPDRAGFQDFDPFWEFVSGPLNAGAFGPNTLDPTFGPEAVFVHAPPTANTAPIDG
FQHFGELNVDGASGDLTVDLRDAAGASLWSKTLHPAGR
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaccgacccaccactcccgccgcacgctcctcaaggccgggctgaccggcgcc
tccgcggtcgccgccggcctcgtcgtgccgtccacggccttcgccgcggtcccgctcgtc
cgccgcgaccgcccggtgctcacccacggcgtccagtccggcgacgtcacgccaggttcg
gcgatcgtctggtcgcgcgcggaccgcccctcgcggctggtcgtcgagatcgcgcgggac
ccgtcgttccggcacgcccggcgcgtgcccggcccgcaggtgggtcccgactccggcggc
accggccgcgtgcgcgtcgcggcgctgcagcccggcaccgagtaccactaccgcgtcacc
gccgaagccctggacgggcgcgccacgagcgagccgctgaccggccggttcgccaccgca
ccggtgggccgccgcgacgcccggatcctgtggtcgggcgacgtcgtcggccagaactgg
gggatcaacccgggcctgggcgggatgacgatcttctccgcgatggccgcccgctgcccg
gacctgttcctgcacagcggcgacacggtgtattccgacggcccgctcaccgagaccgtc
accctccccggcggccggacctggcgcaacatcgtgacgcccgagaagtcgaaggtcgcc
gagacgctggacgagttccgcggccagcacgcctacaaccggctcgacgacaacttcaag
cgcttcgccgcgcaggtgcccgcctacgtgcagtgggacgaccacgaagtcctgaacaac
tggtacccgggcaagatcctcgacaacccggcctacaccgagaagcgcgtcgacgtcctc
gcgccgcgggcgtaccaggcgttccacgagtggcacccgatcgactcgcgccgggctgtc
gacggccgcgtctaccgcagcttcacctacggctcgcgcgtcgagatcttcgtcctcgac
atgcggacctaccgcaacgccaacaccgccgaccgaaccaagccgggctacatcctcggt
gacgcgcaggcccgctggctggccgacgcgctcggccgcagcacggccacctggaagatc
gtccaggccgacatgccgctgggcctggtcgtcccggacggcgccaacatcgaagccgtc
gcgaacaacctgccgggcgcgcccggcggccgcgagacggaactggcgtgggtgctgcgg
gagatccagcgccgccgcgtccgcaacgtcgtctggctgaccgccgacgtccactacacc
gcggcgcaccactactcgcccgaccgggcgggcttccaggacttcgaccccttctgggag
ttcgtgtccgggccgctgaacgcgggggcgttcgggccgaacacgctcgacccgacgttc
ggcccggaggcggtgttcgtgcacgccccgccgacggcgaacacggccccgatcgacggc
ttccagcacttcggcgagctgaacgtcgacggcgcgagcggtgacctcacggtcgatctc
cgcgacgccgccggggcgtcgctgtggtcgaagacactgcacccggcgggccgctga

DBGET integrated database retrieval system