KEGG   Amycolatopsis mediterranei S699: AMES_6702Help
Entry
AMES_6702         CDS       T02190                                 

Gene name
galA
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AMES_6702 (galA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    AMES_6702 (galA)
   00600 Sphingolipid metabolism
    AMES_6702 (galA)
Enzymes [BR:amm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AMES_6702 (galA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7513048..7514616)
Genome map
AA seq 522 aa AA seqDB search
MSSPRRIASAATALAIAASGLVLGAPTAAALENGLLRTPPMGFNNWNSTQCKADFNETMI
KGIADIFVSKGLKDAGYTYVNIDDCWALPSRNSAGNLVPDPARFPDGIKALADYVHGKGL
KFGIYTSAGTKTCNKAGFPGALNHEQQDANLFASWGVDYLKYDNCNNQGVDAQQRYKAMR
DALAKSGRAIAYSICEWGQNQPWTWAAPVGNLWRTTGDISDKWSSMIGKAQTNRGLAQYA
GPGHWNDPDMLEVGNGGMTAAEYRTHFSLWAMMAAPLLIGSDLRKVSDDNFAILKNTDVI
ALDQDPLGKQATVLSANAGLVVYGKVLSNGDRAVALSNETAATATIGTTASATGIGSASS
YTLKDLWSKATRTTTGTISASVPSHSTVLYRVSRAGGSTRYEAESASISAGGTIDANHAG
FSGTGFANGANAVGSYVEWQVTGPASALAFGYANGTTAARPVDVAVDGTVVAAGVPFPAT
GAWTTWSTVVRSLSLPAGSHTVRLTATTADGPANLDYLDVTP
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcacctcgtcgaatcgcgagcgcggccaccgcgctcgcgatcgcggccagcggt
ctcgtcctgggtgcgcccacggcggcggccctcgaaaacggcctgctgcgcacaccgccg
atgggcttcaacaactggaactccacgcagtgcaaagccgacttcaacgaaacgatgatc
aaaggcattgcggacatcttcgtcagcaaggggctgaaggacgccggttacacctacgtc
aacatcgacgactgctgggcgctgccgtcccgcaactcggcgggcaacctggtgcccgat
ccggcgcggttccccgacggcatcaaggccctcgccgactacgtgcacggcaagggcctg
aagttcggcatctacaccagtgccggcacgaagacctgcaacaaggcgggcttccccggc
gcgctgaaccacgagcagcaggacgcgaacctgttcgcctcctggggcgtcgactacctg
aagtacgacaactgcaacaaccagggcgtcgacgcgcagcagcggtacaaggcgatgcgg
gacgcgctcgcgaagtccggccgcgcaatcgcgtactccatctgcgagtggggccagaac
cagccgtggacgtgggccgcgccggtcgggaacctgtggcgcaccaccggcgacatctcc
gacaagtggtcgagcatgatcggcaaggcgcagaccaaccgcggcctcgcgcagtacgcc
ggccccggccactggaacgaccccgacatgctggaggtcggcaacggcgggatgaccgcg
gcggagtaccgcacgcacttcagcctgtgggcgatgatggcggcgccgctgctgatcggc
agcgatctgcgcaaggtgtcggacgacaacttcgcgatcctgaagaacaccgacgtcatc
gcgctcgaccaggacccgctgggcaagcaggcgaccgtgctgagcgccaacgccggcctc
gtcgtctacggcaaggtgctgtccaacggcgaccgcgcggtggcgctgtccaacgaaacg
gccgcgacggcgacgatcggcacgacggcgtccgccaccgggatcgggagcgcctcgtcg
tacacgctcaaggacctgtggagcaaggcgacccggacgaccaccggcacgatcagcgca
tcggtgccctcgcactcgacggtgctgtaccgcgtatcccgcgccggcggttcgacgcgc
tacgaagccgagtccgcgtccatttcggcgggcggcacgatcgacgccaaccacgcgggc
ttctccgggaccggcttcgcgaacggagccaacgcggtcggcagctacgtcgagtggcag
gtgacgggaccggcatcggcgctggcgttcggctacgcgaacggcacgacggcggcgcgt
ccggtggacgtcgcggtggacggcacggtggtggccgcgggcgtcccgttcccggcgacc
ggcgcctggacgacgtggagcacggtggtccggtccttgtccttgccggcgggctcgcac
acggtccgcctgaccgcgacgacggccgacggcccggcgaacctcgactacctggacgtc
acgccgtag

DBGET integrated database retrieval system