KEGG   Amycolatopsis mediterranei S699: AMES_6894Help
Entry
AMES_6894         CDS       T02190                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMES_6894 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMES_6894 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMES_6894 (trpB)
Enzymes [BR:amm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMES_6894 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7747628..7748980)
Genome map
AA seq 450 aa AA seqDB search
MAEQTKYVLDEADLPAQWYNVIPDLPEPPPPPLHPGTREPVGPDDLAPLFPQALIAQEVT
TDRYVDIPDEVREVYRLWRPSPLFRARRLEKALGTPARIYYKYEGVSPVGSHKPNTAVPQ
AFYNAAEGVRRLTTETGAGQWGSALAFACAQYGLECEVWQVRASYDQKPYRKLMMETFGA
TVHPSPSELTESGRAILKQHPDSTGSLGIAISEAVEQAAQDPDTRYALGSVLNHVLLHQT
VIGEEALKQFELAGDTPDLLVGCTGGGSNFGGLAFPFLREKLAGRMDPVIRAVEPAACPS
LTRGKYAYDFGDTAGLTPLLKMHTLGHEFIPDPIHAGGLRYHGMSPLISHIHELGLIEAI
AIGQQECFAAGVRFARSEGIIPAPEPTHALAACIREALRCKETGEEKVILTALCGHAHLD
LPAYGAYLAGDMVDDELSDATLEESLAALP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagaccaaatacgtcctggacgaagccgatctccccgcccagtggtacaac
gtcatccccgacctgcccgagccgccgccaccgccgctgcaccccggcacgcgcgagccc
gtcggcccggacgacctcgcgccgctgttcccgcaggcgctcatcgcccaggaagtgacg
acggatcgctatgtcgacatcccggacgaagtgcgggaagtctaccggctctggcgcccg
tcgccgctgttccgggcgcgacggctggagaaggcgctgggcacccccgcgcggatctac
tacaagtacgaaggcgtcagcccggtcggctcccacaagccgaacaccgccgtgccgcag
gcgttctacaacgcggccgaaggcgtccggcggctgaccaccgagaccggcgccggccag
tgggggagcgcactcgctttcgcctgcgcccagtacgggctggagtgcgaggtctggcag
gtgcgcgcgtcctacgaccagaagccctaccgcaagctgatgatggagacgttcggcgcg
accgtccacccgagcccgtcggagctgaccgagtcgggccgggcgatcctcaagcagcac
ccggactcgacgggcagtctcggcatcgcgatcagcgaggccgtcgagcaggcggcgcag
gacccggacacgcggtacgcgctcggcagcgtgctcaaccacgtgctgctgcaccagacg
gtcatcggtgaggaagcgctgaagcagttcgagctggccggcgacaccccggacctcctg
gtcggctgcaccggcggcggctccaacttcggcgggctcgctttcccgttcctgcgcgag
aaactggccggccggatggacccggtgatccgcgcggtcgagccggcggcgtgcccgtcg
ctgacgcgcggcaagtacgcctacgacttcggcgacaccgccgggctgacaccgctgctg
aagatgcacacgctcggccacgagttcatcccggacccgatccacgcgggcggtttgcgc
taccacgggatgtccccgctgatttcgcacatccacgagctcggcctgatcgaggcgatc
gcgatcggccagcaggagtgtttcgcggcgggggtgcggttcgcccggtccgagggcatc
atcccggcgccggagccgacccacgcgctcgcggcgtgcatccgggaagcgttgcggtgc
aaggaaaccggcgaggagaaggtgatcctgacggcgctgtgcggtcacgcccacctcgac
ctgccggcgtacggtgcttacctcgccggggacatggtggacgacgagctttccgatgcg
acgcttgaggagtctctggccgccttgccctga

DBGET integrated database retrieval system