KEGG   Amycolatopsis mediterranei S699: AMES_6906Help
Entry
AMES_6906         CDS       T02190                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:amm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7759018..7759791
Genome map
AA seq 257 aa AA seqDB search
MELARQVLAGALGRKIRSVDDHDDWVCRPHAPGDIATALRGGRLTEAHRRGKTLWCETEG
GDGRPGPNLGLHLGMAGQLRFAGESGPPGRIRDRDEKPEWFRFGITFADGEQLRLFDTRR
LSRVRLDPDLDALGPDAGEISRRDFAERVGRGRAPLKARLLDQSVVAGIGNLLADETLWQ
AALSPARPVHEMSSDDLGHLHKALRKALRAAIRHGGVHTGEIIGHRRAGEHCPRCGAEMS
HGTVGGRSTWWCSKEQS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtggaactcgcccggcaggtcctcgccggtgcgctcggccggaagatccgctcggtcgac
gaccacgacgactgggtctgccgcccccacgcacccggggacatcgccaccgcgttgcgg
ggcggccggctcaccgaagcgcaccggcggggcaagacactgtggtgcgaaacggaaggc
ggcgacgggcggcccggcccgaacctcggcctgcacctcgggatggccgggcagctgcgg
ttcgccggcgagagcggaccgcccggccggatccgcgaccgggacgagaaacccgagtgg
ttccgcttcggcatcactttcgccgatggcgaacagctgcgcctgttcgacacgcggcgg
ctcagccgggtgcggctcgacccggatctcgacgcgctcggcccggacgccggggagatc
tcgcgccgtgacttcgccgagcgcgtcggccgcggccgggcgccgctgaaggcgcggctg
ctggaccagtcggtggtggcggggatcgggaacctgctggccgacgaaaccctctggcag
gcggcactctccccggcgcggccggtgcacgaaatgagctccgacgacctcggtcacttg
cacaaggcgctgcggaaggcgttgcgcgcggcgatccgccacggcggcgtgcacaccggc
gagatcatcggccaccggcgggcgggcgagcactgcccgcgctgcggcgcggagatgagc
cacggcacggtcggcggccggtcgacctggtggtgttcgaaggagcagtcctag

DBGET integrated database retrieval system