KEGG   Amycolatopsis mediterranei S699: AMES_7090Help
Entry
AMES_7090         CDS       T02190                                 

Gene name
paaG
Definition
(GenBank) enoyl-CoA hydratase/isomerase
Organism
amm  Amycolatopsis mediterranei S699
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFO80624
UniProt: G0FNI8
Position
complement(7954134..7954928)
Genome map
AA seq 264 aa AA seqDB search
MIEDPGAVGLGCRWADGVLWLTLDRPEARNALTIAMRRGLITAIRAADADPQTRVVVLTG
TDPAFSAGVDLKESLGAPRGARTDPAEAVRAARAPVLGVINGPCYTGALELALSCDFLVA
SDRARFADTHAALGLVAGWGMSALLPRAVGVRLARQMMLTGEPVDAGQAVRAGLVNEVVP
HERLAERVRQVVAGILAAAPEAADATLQLLADGEDVPLAHALALEARAKRRRRIDVAEVA
RRFAARTAHVSDHNGMMRTGAEDR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaggatccgggcgccgtcgggctcgggtgccgctgggcggacggggtgctctgg
ctgactctggaccgcccagaggcgcgcaacgcgctgacgatcgcgatgcggcgcggactg
atcaccgcgatccgggcggcggacgcggatccgcagacgcgggtggtcgtgctgaccggg
accgatccggccttctccgcgggcgtcgacctcaaggagtcgctcggggcgccgcgcggc
gcccggaccgacccggcggaggcggtgcgggcggctcgcgctccggtgctcggggtgatc
aacggcccgtgttacaccggagcgctggagctggcgctgtcgtgcgacttcctcgtcgcc
tcggaccgcgcccggttcgccgacacgcacgccgcgctcggcctggtggccgggtggggg
atgagcgcgctgctgccccgggcggtcggcgtgcggctggcccggcagatgatgctgacc
ggcgagcccgtcgacgctgggcaggcggtgcgtgctgggctggtgaatgaggtcgtgccc
cacgagcggctggcggagcgggtccggcaggtcgtggccgggatcctcgccgccgcgccg
gaagcggccgacgccacgctgcagctgctcgccgacggcgaggacgtgcccctggcgcac
gctctcgcgctggaggcgagggcgaagcggcggcggcggatagacgtggcggaggtggcc
cgccggttcgcggcccggaccgctcacgtaagtgaccacaatggaatgatgcgcacggga
gcggaggaccgatga

DBGET integrated database retrieval system